Example Cases
Case 1
A user investigates whether or not 3 experimentally measured peptides, which she/he believes play an important role, are unique for a protein.
The peptides are:
"STELLA",  "SARTW",  "ARTARTS"



Case 2
A user investigates whether or not a list of measured molecular masses from a proteomics experiment contains unique molecular masses for a protein.
These molecular masses are:
2345, 2500, 2800, 3015, 3100 Da.


Case 3
A user investigates whether or not 
around 3000 Da and in a range of 2 Da
are there any unique molecular masses in order to prepare a targeted experiment.



Case 4
A user investigates whether or not the candidate biomarkers Von Willebrand Factor (P04275) and Cathepsin B (P07858) have unique peptide sequences and masses.




Case 1
A user investigates whether or not 3 experimentally measured peptides, which she/he believes play an important role, are unique for a protein.
The peptides are:
"STELLA",  "SARTW",  "ARTARTS"
 

Step A.

In the "Peptide Sequence Search" mode, at the "Search by a List of Peptide Sequences" area, the user submits the sequences 

                                                                    STELLA
                                                                    SARTW
                                                                    ARTARTS

Step B.

    The application returns the following :

1

Protein AC Protein Description Peptide Molecular Mass
Q4KMX7 Protein FAM106A Homo sapiens STELLA
Click to check across species
Click to check enzymatic digestion
632.34

2

SARTW Peptide Sequence is not a core unique sequence

Check for other sequences containing or included in SARTW

3
ARTARTS Peptide Sequence is not a core unique sequence

Check for other sequences containing or included in ARTARTS

Step C.

The user finds that the peptide STELLA is a core unique peptide (CUP) which belongs only to protein Q4KMX7.

Step D.

By clicking on the link "Click to check across species" the user finds that the peptide STELLA is also unique in 10 other species apart from Humans, getting the information of the corresponding proteins (see table below).

Index Species Protein Description
1 XANOR Q5H616 Probable ubiquinone biosynthesis protein ubiB Xanthomonas oryzae pv. oryzae
2 HUMAN Q4KMX7 Protein FAM106A Homo sapiens
3 BPT4 P04521 Exonuclease subunit 1 Bacteriophage T4
4 SHISO P16943 Insertion element IS630 uncharacterized 39 kDa protein Shigella sonnei PE=4 SV=1
5 NOCSI P77816 Steroid Delta-isomerase Nocardioides simplex
6 NITEU Q82TW6 DNA ligase Nitrosomonas europaea
7 XANOM Q2P8Q0 Probable ubiquinone biosynthesis protein ubiB Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
8 YARLI P34229 Fatty acid synthase subunit beta Yarrowia lipolytica
9 ACIAC A1TP97 Trans-aconitate 2-methyltransferase Acidovorax avenae subsp. citrulli (strain AAC00-1)
10 WHEAT Q42430 Zinc finger protein 1 Triticum aestivum PE=2 SV=1
11 ECOLI P39285 Uncharacterized mscS family protein yjeP Escherichia coli (strain K12)

Step E.

By clicking on the link "Click to check enzymatic digestion" the user finds the unique peptide sequences when Q4KMX7 is digested with enzymes (see table below).

Enzyme Position Peptide Sequence Molecular Mass
Trypsin K or R in C term GTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPGAVVSI
SDQPTDQCK
7282.30
Arg-C R in C term GTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPGAVVSI
SDQPTDQCKLAAKELPLR
8273.92
Chymotrypsin F or Y or W or L in C term - -
Formic Acid D in C term PVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCIC
ISSFPNETGNHD
7836.75
Lys-C K in C term MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFA
FSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPG
AVVSISDQPTDQCK
14704.12
PepsinA F or L in C term - -
TrypChymo F or Y or W or L or K or R in C term - -
V8-DE D or E in C term - -
Asp-N D in N term DPVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLHVCI
CISSFPNETGNH
7836.75
Asp-N_ambic D or E in N term - -


Step F.

Now the user continues the investigation with the second peptide (SARTW) which is found to be not a CUP. By clicking on the link "Check for other sequences containing or included in SARTW" the user searches for the corresponding unique subsequences or supersequences. (see table below).

Index Protein Description Supersequence Molecular Mass
1 Q5R3K3 Protein FAM26F Homo sapiens LSARTW
Click to check across species
Click to check enymatic digestion
732.39
SARTWR
Click to check across species
Click to check enymatic digestion
775.41
2 Q8N394 Transmembrane and TPR repeat-containing protein 2 Homo sapiens YSARTW
Click to check across species
Click to check enymatic digestion
782.37

It comes that SARTW has no core unique subsequences and thus it is not a unique sequence. 

However, there are 2 core unique supersequences of SARTW in protein  Q5R3K3 and 1 core unique supersequence of SARTW in protein Q8N394 

Thus, SARTW is part of 3 core unique sequences.

Step G.

The user continues the investigation with the third peptide (ARTARTS) which is found to be not a CUP. By clicking on the link "Check for other sequences containing or included in ARTARTS" the user searches for the corresponding unique subsequences or supersequences. (see table below).

Index Protein Description Subsequence Molecular Mass
1 Q7Z6M4 mTERF domain-containing protein 2 Homo sapiens ARTART
Click to check across species
Click to check enymatic digestion
674.38

It comes that ARTARTS is a unique sequence since it has a core unique subsequence (ARTART) in protein Q7Z6M4 . 


Case 2
A user investigates whether or not a list of molecular masses contains unique molecular masses for a protein.
These molecular masses are: 2345, 2500, 2800, 3015, 3100 Da.

Step A.

In the "Molecular Mass Search", at the "Search by a List of Molecular Masses" area, the user submits the masses
2345
2500
2800
3015
3100

and she/he checks the estimated error check box, inserting the value of 0.2 Da.

Step B.

    The application returns that there are 4 unique molecular masses among the requested masses in the given tolerance range (0.2 Da),
and provides the user with the corresponding Protein AC and Description, the Molecular Mass and the related Isolation Range,
along with the corresponding peptide sequence.

Protein AC Protein Description Molecular Mass Isolation Range Peptide
P32856 Syntaxin-2 Homo sapiens 2799.84 0.01 RKKWIIIAVSVVLVVIIVLIIGLSVG
Which molecular masses can be found in this protein?

Protein AC Protein Description Molecular Mass Isolation Range Peptide
Q13387 C-jun-amino-terminal kinase-interacting protein 2 Homo sapiens 2799.88 0.01 DDNEEEDDEDEEEEEEEEEGDGEG
Which molecular masses can be found in this protein?

Protein AC Protein Description Molecular Mass Isolation Range Peptide
Q5GH76 XK-related protein 4 Homo sapiens 2799.89 0.01 EAAGGGCCPDGGGCSRCCCCCAGSGGSAGSGGSG
Which molecular masses can be found in this protein?

Protein AC Protein Description Molecular Mass Isolation Range Peptide
Q9H2G4 Testis-specific Y-encoded-like protein 2 Homo sapiens 2799.87 0.01 DEASDDEDNDGNEGDNEGSDDDGNEGD
Which molecular masses can be found in this protein?

Step C.

The user clicks on the option Which molecular masses can be found in this protein? under the protein Q13387 and observes that
there are also other molecular masses from the given in the list that can be found in this protein (and thus they can reinforce a protein identification):

Molecular Mass Peptide Sequence
2345.11 GQCLSPAPRPPGEPVSPAGGAAQDS
2500.16 CLSPAPRPPGEPVSPAGGAAQDSQDP
2499.82 EMIDDNEEEDDEDEEEEEEE
MIDDNEEEDDEDEEEEEEEE
2345.01 SEEEAGAALLGGGQVSGDTSPDSPD
2500.05 GLGHDSEEDSGGEASEEEAGAALLGGG
HDSEEDSGGEASEEEAGAALLGGGQV
3100.10 SAACSEEEDEEDDEEEEDAEDSAGSPGGRG
ACSEEEDEEDDEEEEDAEDSAGSPGGRGTG
2500.03 QDISLEEFDDEDLSEITDDCGL
2799.88 DDNEEEDDEDEEEEEEEEEGDGEG
2799.94 AACSEEEDEEDDEEEEDAEDSAGSPGG

Case 3
A user investigates whether or not around 3000 Da and in a range of 2 Da
are there any unique molecular masses.



Step A.

In the "Molecular Mass Search", at the "Search by a Single Molecular Mass" area, the user submits
Molecular Mass 3000 

and she/he checks the estimated error check box, inserting the value of 2 Da.

Step B.

Then , by submitting the query, it comes that there are 3 unique masses in the defined area (one in protein A8MXZ3 and two in protein Q86TY3):

Protein AC Protein Description Molecular Mass Isolation Range Peptide
A8MXZ3 Putative keratin-associated protein 9-2-like 3 Homo sapiens PE=3 SV=1 3001.02 0.01 SCGSSCCQPICGSSCCQPCCHPTCYQTIC


Protein AC Protein Description Molecular Mass Isolation Range Peptide
Q86TY3 Uncharacterized protein C14orf37 Homo sapiens 3001.96 0.01 EDEEDEEDEDEEEEDEEEDEEDKD
3001.96 0.01 DEDEEDEEDEDEEEEDEEEDEEDK
Case 4
A user investigates whether or not the candidate biomarkers Von Willebrand Factor (P04275)
and Cathepsin B (P07858) have unique peptide sequences and masses.


Step A.

In the "Protein Search" mode the user submits the Accession Number P07858.

Step B.

By clicking on Molecular Mass Results the user finds that
there are 6 distinct molecular masses that are found only in this protein:

Molecular Mass Isolation Range Peptide
1035.26 0.01 TCCGSMCGDGC
1048.25 0.01 CCGSMCGDGCN
1105.28 0.01 CCGSMCGDGCNG
1162.30 0.01 CCGSMCGDGCNGG
1206.32 0.02 TCCGSMCGDGCNG
1263.34 0.01 TCCGSMCGDGCNGG

Step C.

By clicking on Core Peptide Sequences Results the user finds that
there is a group of Core Unique Peptides for this protein:

Core Peptides Molecular Mass
CWAFG 582.23
CEPGYS 654.23
PCTGEG 562.21
RICIH 640.35
PTYKQD 750.35
EHHVNG 691.30
QWPQC 660.27
IPPCE 557.25
DMSYLK 755.35
ASFDAR 665.31
ISDRI 602.34
KLPASF 661.38
SHVGC 501.20
GEGDTP 574.22
NGTPY 550.24
DLKLPA 655.39
ELVNYV 735.38
FDAREQ 764.34
VANSW 575.27
GIPRTD 657.34
SDFLLY 756.37
YKNGP 577.29
AFGAVE 592.29
GHNFY 636.27
GGHAIR 609.33
LWASLC 691.34
QRVMF 679.35
VMFTED 740.30
GPVEGA 528.25
KQDKH 654.34
YSVSNS 655.28
PLSDEL 672.33
AHVSVE 640.32
GDGCN 464.13
LTCCGS 582.21
SFHPLS 686.34
NARSRP 699.38
GVENGT 575.25
AGIPRT 613.35
GSCGSC 512.14
HYGYNS 739.29
VNKRNT 730.41
IRDQGS 674.33
VYSDF 629.27
DQGSC 508.16
TFLGGP 590.31
SMCGD 511.14
DIMAEI 690.33
WASLCC 681.26
RKGLVSG 715.43
GLVSGGL 601.34
NTDWG 591.23
FYNVDM 787.32
NFYNVD 770.32
TGEMM 567.20
SYSVSN 655.28
GYSPTY 686.29
MGGHA 471.19
PTIKEI 699.42
WGVEN 603.26
CGIES 507.20
LYESH 647.29
VSAEDLL 745.39
KICEPG 645.32
AEDLLT 660.33
CCLLV 549.26
CGTFLG 596.26
SDELVN 675.31
FWTRKG 793.42
FKILRG 732.46
GDNGFF 655.26
PSFHPL 696.36
ESEVVA 632.30
GAFSVY 642.30
KRLCGT 676.37
TWQAG 561.25
GYNSYS 689.27
RILGW 643.38
QGSCGS 537.18
LGGPKPP 664.39
DTPKCS 649.27
EKDIMA 705.34
AEAWNF 736.32
ILRGQD 700.39
NGGYP 506.21
GVYQH 602.28
MMGGH 531.19
YPAEA 549.24
LVLANA 599.36
VEVSAED 747.33
QCPTI 560.26
DWGDN 605.21
PYSIPP 672.35
TEDLKL 717.39
CIHTNA 657.29
FLGGPK 617.35
CPTIKE 689.34
GSRPPC 615.28
LYKSGV 665.37
TDQYWE 840.33
TRKGLVS 759.46
LANARS 630.34
NFWTR 722.35
YWEKI 737.37
DHCGI 543.21
PPCTGE 602.24
GYPAE 535.23
CGSMCG 556.14
GCNGGY 569.19
HVGCR 570.27
CTGEGD 580.18
GEMMG 523.18
PPCEH 581.23
MCGDGC 584.14
TCCGSM 600.17
WLVAN 601.32
CCGSMC 602.13
TTWQA 605.28
GQDHCG 615.21
VENGTP 615.29
KGLVSGG 616.35
VEAISD 632.30
GIESEV 632.30
VLANAR 642.38
WAFGAV 649.32
YWLVA 650.34
SRPPCT 659.31
LGWGVE 659.33
TPKCSK 662.34
GHAIRI 665.40
DLLTCC 666.27
QHVTGE 669.31
HVTGEM 672.29
QAGHNF 672.30
SEVVAGI 673.36
IESEVV 674.35
SKICE 578.27
HTNAHV 677.32
GPKPPQ 622.34
LLYKSG 679.39
ICEPGY 680.28
KCSKIC 680.33
KSGVYQ 680.35
GCRPYS 681.29
EVVAGIP 683.38
PAEAWN 686.30
EAISDR 689.33
ANSWNT 691.29
IHTNAH 691.34
EDLLTC 692.30
HNFYN 693.29
VGCRPY 693.33
WGDNGF 694.27
HPLSDE 696.31
KNGPVEG 699.35
PVEGAF 618.30
DRICI 618.32
FGAVEAI 705.37
EGAFSV 608.28
LVSGGLY 707.38
VVAGIPR 710.44
SGGLYE 624.27
WQAGHN 711.31
FHPLSD 714.33
YKSGVY 715.35
FSVYSD 716.30
EIRDQG 716.34
SRPSFH 729.36
WPQCPT 730.31
RPYSIP 731.40
NKRNTT 732.39
SWNTD 621.24
TPYWL 678.34
VNYVNK 735.39
AEIYKN 736.38
CEHHV 623.25
CRPYSI 737.35
RPSFHP 739.38
CLLVLAN 744.42
VYQHVT 745.38
QDKHYG 746.33
EPGYSP 648.27
SVSNSE 621.26
DELVNY 751.34
FTEDLK 751.37
QYWEK 752.35
MFTEDL 754.32
HVSVEV 668.35
YSDFLL 756.37
YSPTYK 757.36
MWQLW 762.35
HVNGSR 668.33
FLLYKS 769.44
SNSEKD 678.28
KHYGYN 780.35
DKHYGY 781.34
RVMFTE 781.38
TYKQDK 781.40
AREQW 688.33
WQLWAS 789.38
YVNKRN 792.42
NYVNKR 792.42
YLKRLC 794.45
MSYLKR 796.43
DFLLYK 797.43
RNTTWQ 804.39
KRNTTW 804.42
SEKDIM 721.33
GFFKIL 723.43
NGFFKI 724.39
VDMSYL 726.33
REQWPQ 842.40
AWNFW 722.32
KPPQRV 723.44
SCGSCWAF 859.30
IMAEIY 738.36
RTDQYW 867.39
TIKEIR 758.46
NVDMSY 727.28
IPRTDQ 728.38
IKEIRDQ 900.50
DGCNGG 521.15
EMMGG 523.18
LLTCCG 608.27
GDTPKC 619.26
PCEHH 621.23
GGLYES 624.27
NAHVSV 625.32
NGSRPP 626.31
TNAHVS 627.30
LPASFD 648.31
YSIPPC 678.30
SVEVSAE 719.33
WNTDW 720.29
LVNYVN 720.38
PKPPQR 721.42
HAIRIL 721.46
EIYKNG 722.36
SFDARE 723.32
LRGQDH 724.36
DNGFFK 726.33
PPQRVM 726.38
YNVDMS 727.28
PRTDQY 778.36
SYLKRL 778.47
RLCGTFL 808.43
ARSRPSF 819.43
FFKILR 822.51
WTRKGLV 858.51

Step D.

By clicking on Click to Check Enzymatic Digestion the user finds the Unique Peptide Sequences of P07858 derived from enzymatic digestion:


Enzyme Position Peptide Sequence Molecular Mass
Trypsin K or R in C term MWQLWASLCCLLVLANAR 2090.06
PSFHPLSDELVNYVNK 1857.93
NTTWQAGHNFYNVDMSYLK 2288.03
LCGTFLGGPK 991.52
VMFTEDLK 981.48
LPASFDAR 875.45
EQWPQCPTIK 1228.59
DQGSCGSCWAFGAVEAISDR 2057.86
ICIHTNAHVSVEVSAEDLLTCCGSMCGDGC
NGGYPAEAWNFWTR
4716.01
GLVSGGLYESHVGCR 1532.74
PYSIPPCEHHVNGSR 1691.78
PPCTGEGDTPK 1100.48
ICEPGYSPTYK 1256.57
HYGYNSYSVSNSEK 1633.70
DIMAEIYK 981.48
NGPVEGAFSVYSDFLLYK 2004.98
SGVYQHVTGEMMGGHAIR 1928.90
ILGWGVENGTPYWLVANSWNTDWGDNGFFK
3442.60
GQDHCGIESEVVAGIPR 1765.84
TDQYWEK 968.42
Arg-C R in C term MWQLWASLCCLLVLANAR 2090.06
PSFHPLSDELVNYVNKR 2014.03
NTTWQAGHNFYNVDMSYLKR 2444.13
LCGTFLGGPKPPQR 1469.78
VMFTEDLKLPASFDAR 1838.92
EQWPQCPTIKEIR 1626.82
DQGSCGSCWAFGAVEAISDR 2057.86
ICIHTNAHVSVEVSAEDLLTCCGSMCGDGC
NGGYPAEAWNFWTR
4716.01
KGLVSGGLYESHVGCR 1660.84
PYSIPPCEHHVNGSR 1691.78
PPCTGEGDTPKCSKICEPGYSPTYKQDKHY
GYNSYSVSNSEKDIMAEIYKNGPVEGAFSV
YSDFLLYKSGVYQHVTGEMMGGHAIR
9505.39
ILGWGVENGTPYWLVANSWNTDWGDNGFFK
ILR
3824.87
GQDHCGIESEVVAGIPR 1765.84
TDQYWEKI 1081.51
Chymotrypsin F or Y or W or L in C term ANARSRPSF 1004.51
VNKRNTTW 1017.54
QAGHNF 672.30
NVDMSY 727.28
GGPKPPQRVMF 1212.64
DAREQW 803.36
PQCPTIKEIRDQGSCGSCW 2106.93
GAVEAISDRICIHTNAHVSVEVSAEDL 2834.39
TCCGSMCGDGCNGGY 1426.41
ESHVGCRPY 1046.46
SIPPCEHHVNGSRPPCTGEGDTPKCSKICE
PGY
3494.55
KQDKHY 817.41
SVSNSEKDIMAEIY 1584.73
KNGPVEGAF 917.46
QHVTGEMMGGHAIRIL 1748.88
GVENGTPY 835.37
VANSW 575.27
RGQDHCGIESEVVAGIPRTDQY 2429.14
Formic Acid D in C term MWQLWASLCCLLVLANARSRPSFHPLSD 3213.60
ELVNYVNKRNTTWQAGHNFYNVD 2781.33
MSYLKRLCGTFLGGPKPPQRVMFTED 2970.49
LKLPASFD 889.49
AREQWPQCPTIKEIRD 1968.98
QGSCGSCWAFGAVEAISD 1786.73
RICIHTNAHVSVEVSAED 1978.95
LLTCCGSMCGD 1101.40
GCNGGYPAEAWNFWTRKGLVSGGLYESHVG
CRPYSIPPCEHHVNGSRPPCTGEGD
5900.65
TPKCSKICEPGYSPTYKQD 2143.99
KHYGYNSYSVSNSEKD 1876.82
IMAEIYKNGPVEGAFSVYSD 2189.03
FLLYKSGVYQHVTGEMMGGHAIRILGWGVE
NGTPYWLVANSWNTD
5066.46
NGFFKILRGQD 1293.68
HCGIESEVVAGIPRTD 1681.81
QYWEKI 865.43
Lys-C K in C term MWQLWASLCCLLVLANARSRPSFHPLSDEL
VNYVNK
4173.11
RNTTWQAGHNFYNVDMSYLK 2444.13
RLCGTFLGGPK 1147.62
PPQRVMFTEDLK 1459.75
LPASFDAREQWPQCPTIK 2086.03
EIRDQGSCGSCWAFGAVEAISDRICIHTNA
HVSVEVSAEDLLTCCGSMCGDGCNGGYPAE
AWNFWTRK
7282.17
GLVSGGLYESHVGCRPYSIPPCEHHVNGSR
PPCTGEGDTPK
4288.98
ICEPGYSPTYK 1256.57
HYGYNSYSVSNSEK 1633.70
DIMAEIYK 981.48
NGPVEGAFSVYSDFLLYK 2004.98
SGVYQHVTGEMMGGHAIRILGWGVENGTPY
WLVANSWNTDWGDNGFFK
5353.49
ILRGQDHCGIESEVVAGIPRTDQYWEK 3098.52
PepsinA F or L in C term ANARSRPSF 1004.51
VNYVNKRNTTWQAGHNF 2048.00
YNVDMSYL 1003.43
GGPKPPQRVMF 1212.64
DAREQWPQCPTIKEIRDQGSCGSCWAF 3110.38
GAVEAISDRICIHTNAHVSVEVSAEDL 2834.39
TCCGSMCGDGCNGGYPAEAWNF 2241.77
YESHVGCRPYSIPPCEHHVNGSRPPCTGEG
DTPKCSKICEPGYSPTYKQDKHYGYNSYSV
SNSEKDIMAEIYKNGPVEGAF
8984.05
SVYSDF 716.30
YKSGVYQHVTGEMMGGHAIRIL 2446.22
GWGVENGTPYWL 1377.63
VANSWNTDWGDNGF 1581.65
RGQDHCGIESEVVAGIPRTDQYWEKI 2985.44
TrypChymo F or Y or W or L or K or R in C term QAGHNF 672.30
NVDMSY 727.28
PQCPTIK 785.41
DQGSCGSCW 941.30
GAVEAISDR 916.46
ICIHTNAHVSVEVSAEDL 1935.94
TCCGSMCGDGCNGGY 1426.41
ESHVGCR 786.34
SIPPCEHHVNGSR 1431.67
PPCTGEGDTPK 1100.48
ICEPGY 680.28
SVSNSEK 749.36
DIMAEIY 853.39
NGPVEGAF 789.37
QHVTGEMMGGHAIR 1522.71
GVENGTPY 835.37
VANSW 575.27
GQDHCGIESEVVAGIPR 1765.84
V8-DE D or E in C term MWQLWASLCCLLVLANARSRPSFHPLSD 3213.60
LVNYVNKRNTTWQAGHNFYNVD 2652.28
MSYLKRLCGTFLGGPKPPQRVMFTE 2855.46
LKLPASFD 889.49
QWPQCPTIKE 1228.59
QGSCGSCWAFGAVE 1400.55
RICIHTNAHVSVE 1477.75
LLTCCGSMCGD 1101.40
GCNGGYPAE 866.32
AWNFWTRKGLVSGGLYE 1983.00
SHVGCRPYSIPPCE 1543.69
HHVNGSRPPCTGE 1389.62
TPKCSKICE 1007.48
PGYSPTYKQD 1154.52
KHYGYNSYSVSNSE 1633.70
IYKNGPVE 918.48
GAFSVYSD 844.36
FLLYKSGVYQHVTGE 1739.89
MMGGHAIRILGWGVE 1625.82
NGTPYWLVANSWNTD 1736.78
NGFFKILRGQD 1293.68
VVAGIPRTD 926.52
Asp-N D in N term MWQLWASLCCLLVLANARSRPSFHPLS 3098.58
DELVNYVNKRNTTWQAGHNFYNV 2781.33
DMSYLKRLCGTFLGGPKPPQRVMFTE 2970.49
DLKLPASF 889.49
DAREQWPQCPTIKEIR 1968.98
DQGSCGSCWAFGAVEAIS 1786.73
DRICIHTNAHVSVEVSAE 1978.95
DLLTCCGSMCG 1101.40
DGCNGGYPAEAWNFWTRKGLVSGGLYESHV
GCRPYSIPPCEHHVNGSRPPCTGEG
5900.65
DTPKCSKICEPGYSPTYKQ 2143.99
DKHYGYNSYSVSNSEK 1876.82
DIMAEIYKNGPVEGAFSVYS 2189.03
DFLLYKSGVYQHVTGEMMGGHAIRILGWGV
ENGTPYWLVANSWNT
5066.46
DNGFFKILRGQ 1293.68
DHCGIESEVVAGIPRT 1681.81
DQYWEKI 980.46
Asp-N_ambic D or E in N term MWQLWASLCCLLVLANARSRPSFHPLS 3098.58
ELVNYVNKRNTTWQAGHNFYNV 2666.30
DMSYLKRLCGTFLGGPKPPQRVMFT 2841.45
DLKLPASF 889.49
EQWPQCPTIK 1228.59
DQGSCGSCWAFGAV 1386.53
DRICIHTNAHVSV 1463.73
DLLTCCGSMCG 1101.40
DGCNGGYPA 852.31
EAWNFWTRKGLVSGGLY 1983.00
ESHVGCRPYSIPPC 1543.69
EHHVNGSRPPCTG 1389.62
DTPKCSKIC 993.46
EPGYSPTYKQ 1168.54
DKHYGYNSYSVSNS 1619.68
EIYKNGPV 918.48
EGAFSVYS 858.38
DFLLYKSGVYQHVTG 1725.87
EMMGGHAIRILGWGV 1625.82
ENGTPYWLVANSWNT 1750.79
DNGFFKILRGQ 1293.68
DHCGI 543.21
EVVAGIPRT 940.53

Step E.

In the "Protein Search" mode the user submits the Accession Number P04275.

Step F.

By clicking on Molecular Mass Results the user finds that
there are 6 distinct molecular masses that are found only in this protein:

Index Molecular Mass Isolation Range Peptide
1 1165.32 0.01 QCCDEYECAC
2 1263.90 0.01 LKKKKVIVIPV
3 1517.44 0.01 GTCCDTCEEPECND

Step G.

By clicking on Core Peptide Sequences Results the user finds that
there is a group of Core Unique Peptides for this protein:

Index Core Peptides Molecular Mass
1 TCCDTC 644.16
2 RWTCP 661.30
3 CSDGRE 665.24
4 FNIFA 610.31
5 KQTMV 605.32
6 GKTCGL 577.29
7 KTCGLCGN 794.34
8 YARTC 612.27
9 CSQPLD 661.27
10 SDPYD 595.21
11 DCNKL 591.27
12 GEDGVQ 603.25
13 ASPENP 613.27
14 VEEDPV 686.31
15 DGQDIQ 674.29
16 YCSRLL 753.38
17 TEPMQ 604.25
18 SPKTFA 649.34
19 MASQEP 661.27
20 IKRLPG 682.45
21 QQRDEI 787.38
22 LERIGW 772.42
23 FAKAFI 695.40
24 EVKHSA 669.34
25 PMVKL 586.35
26 VAQCSQ 634.27
27 GPGKTV 557.32
28 VSPLPY 674.36
29 TLGNSF 637.31
30 GKILDEL 786.45
31 CAMSC 513.14
32 CRCMV 610.24
33 FVRIC 636.34
34 GSSSFPA 651.29
35 PPFDE 603.25
36 YVLVQD 735.38
37 CSLFGS 612.26
38 ACHRAV 655.32
39 TGNPAS 545.24
40 FARCH 632.28
41 HEVLNA 681.34
42 CHKVLA 669.36
43 CADTRK 692.33
44 SLSCRP 661.32
45 GKALSV 573.35
46 IMKIP 600.37
47 CCDTCE 672.15
48 CTDME 597.18
49 CGCTT 483.15
50 SCGDH 517.16
51 RYNSCA 712.30
52 CHTVT 559.24
53 YDTCS 587.19
54 PENPCL 671.29
55 GEIFQP 689.34
56 VDELEQ 731.33
57 CARTC 552.21
58 RVSPPS 641.35
59 ECNDI 592.22
60 CMKSI 580.27
61 ADAARS 589.28
62 PTMVT 547.27
63 GNSFLH 673.32
64 SIVIET 660.37
65 LRNCR 660.35
66 QAPENK 685.34
67 TRSVTV 661.38
68 SCESIG 594.23
69 DCACF 557.16
70 QQDSC 579.20
71 DFVNT 594.26
72 DVVNLT 659.35
73 CPPSLV 614.31
74 CPCFH 605.21
75 QTCVDP 661.27
76 CLVPDS 632.28
77 GTVIGP 542.31
78 NVYGAI 635.33
79 AIMHE 599.27
80 CRSGFT 669.29
81 TCNPC 536.17
82 VALCEK 661.35
83 SFLVSQ 679.35
84 AEPRVE 699.35
85 IGDALG 544.29
86 HIVTF 615.34
87 ASYAHL 660.32
88 IQQRNV 756.42
89 MVLDVA 646.34
90 VKLKHG 680.43
91 CHCDV 575.18
92 MKDETH 759.32
93 NPCLIN 672.33
94 GDVWT 576.25
95 YFNKTC 774.34
96 THFEVV 730.36
97 EDFGNA 651.25
98 VEDFGN 679.28
99 IGEAD 503.22
100 KEYAPG 663.32
101 CLPSAC 592.23
102 FCKVN 609.29
103 QRCCS 595.22
104 LCRTNG 662.32
105 LVDVMQ 703.36
106 NEFQL 649.31
107 VTVNGR 644.36
108 VPVCPS 600.29
109 VTGCPP 572.26
110 AQVTVG 573.31
111 VCEVAG 576.26
112 QIMTL 604.32
113 RYPPGT 689.35
114 GDFQNG 636.25
115 DAAQLR 672.35
116 GIGPH 479.25
117 PHANL 550.29
118 HCDGN 544.17
119 PSSSCN 593.21
120 QPCPTA 615.27
121 PGECRP 657.29
122 PPGLYM 676.32
123 QSCEER 750.30
124 AHVCA 499.22
125 FETLPR 761.41
126 GEAYG 495.20
127 CQLLKS 690.37
128 DGEVNV 631.28
129 NKEQDL 745.36
130 MGLRVA 645.36
131 MSRNF 653.29
132 LNCPK 573.29
133 EECKRV 762.37
134 QYVKVG 692.39
135 HAHCP 563.23
136 PGECLV 616.29
137 LQMDW 691.30
138 ERNLRE 815.42
139 PGECQY 695.26
140 TSEMH 603.23
141 KSVGSQ 604.32
142 PHCERG 697.30
143 ISEPPL 654.36
144 PVPHCE 680.29
145 QAPNL 541.29
146 VPYVGG 590.31
147 GSDKIG 575.29
148 QNGKRV 700.40
149 GVGPNA 513.25
150 QDQCS 579.20
151 LEGSCV 606.27
152 GCDTH 531.17
153 VNSTVS 605.30
154 DAVMGL 604.29
155 GIQNND 659.29
156 CHPLVD 682.31
157 CAEGTR 635.27
158 DGSGNF 595.22
159 SGNFQV 650.30
160 CPALLE 644.32
161 PIGIGD 570.30
162 LKQTYQ 779.42
163 VLKQTY 750.43
164 GWPNA 543.24
165 NEECPG 647.22
166 GACSPG 490.18
167 DGEIFQ 707.31
168 QGKCA 505.23
169 EMKSFA 711.33
170 QGCMK 565.23
171 NFDGIQ 692.31
172 AVCTRS 635.31
173 CPSGFQ 637.25
174 PTACTI 604.29
175 SWKSVG 662.34
176 HDFYC 683.24
177 RGDSQS 648.28
178 RGLQPT 670.38
179 NPRMT 617.29
180 FKSFDN 756.34
181 QPEDIF 747.34
182 LVSQGD 617.30
183 RDEIVS 717.37
184 PGETVK 629.34
185 VLSSVDE 747.36
186 SDHSFL 704.31
187 PTTLYV 692.37
188 TGQSHF 675.30
189 RYLSDH 789.38
190 VILHN 594.35
191 KYAGSQ 652.32
192 EAPDLV 642.32
193 GSLLPD 600.31
194 VVLKQT 686.43
195 ILAGPA 540.33
196 LPLLKGD 754.46
197 MCYCE 647.17
198 AMECK 580.23
199 FCPPGL 632.30
200 RTPDFC 737.32
201 DWRTPD 788.34
202 GGNMEV 605.25
203 CPKGQV 630.32
204 CPPGMV 602.26
205 ACAVLT 576.29
206 SCDLPP 630.27
207 VLTSPT 616.34
208 NSWKV 632.33
209 CAVLTS 592.29
210 YPVGQ 562.27
211 HKLCSG 643.31
212 VRLSYG 693.38
213 KYLFPG 723.40
214 CQKRSF 767.37
215 NFVRYV 796.42
216 GCQKR 590.30
217 NVVPEK 684.38
218 HLSISV 654.37
219 PLDVIL 668.41
220 GQTLLK 658.40
221 VSTLGP 572.32
222 PGDIQ 528.25
223 LVKLSP 655.43
224 CGRCLP 647.29
225 NPSDPE 657.26
226 VPDHQP 691.33
227 GCTTTT 582.23
228 NDFML 638.27
229 MVDSSC 640.22
230 VSCPLG 574.28
231 WKVSS 605.32
232 HNGAC 500.18
233 SPRKCS 676.33
234 VGVISG 530.31
235 VVDMM 593.25
236 VLAPAT 570.34
237 DVPWN 629.28
238 SIHVTV 654.37
239 RIQHT 653.36
240 TPSGLA 544.29
241 HTMCY 653.23
242 TECPC 551.17
243 CGSNPG 533.19
244 EENNTG 662.25
245 LSCKT 550.28
246 ERCPC 606.22
247 ECKCSP 665.25
248 MIDVC 579.24
249 IGCNT 506.22
250 VCEVIA 632.32
251 LTSDVF 680.34
252 AMYSI 583.27
253 GEFFD 613.24
254 EMHGA 543.21
255 RDGTVT 647.32
256 GFVARI 661.39
257 LPREAP 681.38
258 QCLVP 558.28
259 PYASK 564.29
260 VLLSDR 701.41
261 NHLGHI 689.36
262 TSEVLK 675.38
263 VLKYTL 735.45
264 GRLVSV 629.39
265 TQVSVLQ 773.43
266 KQIRLI 769.52
267 VQGLKK 671.43
268 QGLKKK 700.46
269 NTCIC 552.20
270 CQICT 566.22
271 VTCQH 586.25
272 SSPATC 564.22
273 SQPLDV 657.33
274 RYDVC 654.28
275 FKLTGS 651.36
276 VTVEYP 706.35
277 ATFYAI 684.35
278 QIPTLS 657.37
279 RIDGSG 603.30
280 KVNERG 701.38
281 VCVHR 612.32
282 ILQRVR 783.51
283 DTCEEP 692.23
284 DFMTQ 640.25
285 CACNC 512.12
286 NYNGN 580.22
287 CNISSG 579.23
288 NGNQGD 603.22
289 LLAGGC 532.27
290 CHRAVS 671.32
291 ARTCQS 664.30
292 VRYLTS 737.41
293 VQEWT 661.31
294 NPASDE 631.24
295 TVGPGL 542.31
296 LPLFAE 688.38
297 TILVEG 630.36
298 QERCV 633.29
299 VCTGSS 552.22
300 NFTCA 554.22
301 CVCDPV 634.24
302 ICDENG 649.24
303 SPVCPA 572.26
304 GMEYR 654.28
305 STARC 536.24
306 EKVCGL 647.33
307 GPSQIG 557.28
308 PSCPNS 603.23
309 DGVQHQ 682.30
310 HENRC 657.26
311 MSGVPG 546.25
312 CVHSG 501.20
313 SDRYFN 800.34
314 CRPPM 602.27
315 SKGDIL 631.35
316 KAVVIL 641.45
317 GVLLALA 655.43
318 GCDVCT 596.19
319 TCRCM 612.22
320 FSEEAC 684.24
321 VSCDLP 632.28
322 QWASP 587.27
323 HSDME 617.21
324 CPADNL 631.26
325 GNAWK 574.29
326 GICQY 582.25
327 VSCPQL 645.32
328 VEYHD 661.27
329 YASKGL 637.34
330 GLCEVA 590.27
331 LLLDGSS 703.37
332 ACPVQ 516.24
333 QCVEG 534.21
334 KTQCC 581.23
335 ICTCL 551.24
336 PGRCEL 673.32
337 EPQRM 659.31
338 CPNSQS 634.24
339 PCLINE 687.33
340 ACAGRG 533.24
341 VTLNPS 629.34
342 AFISKA 635.36
343 SRIALL 671.43
344 SVKCK 563.31
345 YIILLL 746.49
346 TSLSRD 677.33
347 QDYCGS 671.22
348 INDVQ 587.29
349 NGVCVD 605.25
350 ELLQTC 705.34
351 PILIQD 697.40
352 TLFQIF 767.42
353 YTLFQI 783.42
354 VTDVSV 618.32
355 ARSNR 602.32
356 PCYYD 659.23
357 ADQCCP 635.20
358 GQLLDEG 730.35
359 DAAADA 532.21
360 TFASKT 653.34
361 GTVTQG 561.28
362 TIQLR 629.39
363 TWRTA 633.32
364 GSSRLSE 734.36
365 EEVFIQ 763.37
366 AQCPCY 683.24
367 GDHPSE 640.24
368 CFCDT 587.17
369 EHKCLA 699.34
370 PTFEAC 666.27
371 TDHSA 529.21
372 MDVGQD 663.25
373 SFSIVI 664.38
374 EMQKGL 704.35
375 LQTCVD 677.30
376 QVASTS 591.29
377 CMVQVG 635.28
378 GNFQVL 676.35
379 DVAFVL 662.36
380 DGSSSFP 695.28
381 VVESGR 645.34
382 IGLKDR 700.42
383 SFPASY 670.30
384 CTQCI 566.22
385 GDCVPK 617.28
386 DPEPYL 732.33
387 VQCAD 534.21
388 ANSWA 547.24
389 NPCPLG 599.27
390 CPLGYK 679.34
391 SVDAAA 532.25
392 LTPSGL 586.33
393 CTTQP 548.23
394 SKIDRP 714.40
395 VDPEPF 702.32
396 HGARPG 593.30
397 FASGKK 636.36
398 ALILPG 582.37
399 VCSCSD 612.19
400 DCQDHS 703.22
401 GNQGDD 604.21
402 GDDFLT 666.29
403 SSGEQW 692.28
404 EVIQRM 774.41
405 GYYKL 642.34
406 LRENGY 750.37
407 ENGYE 610.22
408 DMMERL 793.35
409 TLCAEG 592.25
410 IPGTCC 592.23
411 KLCSGF 653.32
412 LKAFVV 675.43
413 FSIIGD 650.33
414 LDGSSSF 711.31
415 VPIGVG 540.33
416 LECMS 581.22
417 QDGCD 536.15
418 VGQFW 635.31
419 CMDED 611.16
420 EETCGC 640.18
421 VGSCKS 579.27
422 YVLHEG 716.35
423 FFDIH 677.32
424 PGGLVVP 637.38
425 IASQVK 644.39
426 VISGFK 649.38
427 PTLSPAP 681.37
428 LVVPPT 624.38
429 KKKVIV 713.52
430 CCDEY 631.16
431 DATCST 596.21
432 WCERA 663.28
433 PCEDSC 652.18
434 GTPCN 490.18
435 PGLYMD 694.30
436 NGANDF 636.25
437 DFNRS 637.28
438 CPPDKV 657.32
439 TRFSEE 767.34
440 FMEEVI 766.36
441 CEVAGR 633.29
442 APPPTLP 691.39
443 RLQYVK 805.48
444 EVLKAF 705.41
445 GDLRIQ 700.39
446 EGECCG 596.16
447 MGCVSG 552.20
448 ECVCDP 664.22
449 HEGECC 676.19
450 ACMLN 550.22
451 FDEMKS 755.32
452 GECQYV 697.27
453 VSMPY 595.27
454 AQEGMV 633.28
455 GMAHY 577.23
456 LTCRSL 691.37
457 AGGCQK 562.25
458 ASVRLS 631.36
459 TLTNPG 601.31
460 AVLSSPL 685.40
461 QIFSKI 734.43
462 CGDHPS 614.21
463 VCDATC 610.21
464 CNEACL 651.24
465 CDENGA 607.19
466 MVTVEY 740.34
467 SRLSEAE 790.38
468 RSLSYPD 836.40
469 SKEFME 769.33
470 FPGEC 551.20
471 HLLSLV 680.42
472 SPLSHR 695.37
473 HGKVVT 639.37
474 ILLLDGS 729.43
475 RPSELR 756.42
476 GASKAVV 630.37
477 CECAG 481.13
478 CLPTAC 606.25
479 QCVSPC 635.24
480 ARIDGS 617.31
481 DRYFNK 841.41
482 PLFAEC 678.30
483 RLPGDI 669.38
484 IGPRLT 655.40
485 PGTLCA 560.26
486 PDEEC 591.18
487 CEHGC 547.15
488 CSPVCP 604.23
489 GEDLQM 691.28
490 NDCGC 510.12
491 NSCAP 490.18
492 TSDVFQ 695.31
493 FSEAQS 667.28
494 GDCQDL 649.24
495 NCDRG 563.21
496 YFWEK 771.36
497 FDGLKY 741.37
498 AECHKV 685.32
499 RRIASQ 729.42
500 AEGGKI 573.31
501 CPEYE 639.22
502 HCTMS 577.20
503 RDCQD 635.23
504 GQDSIH 655.29
505 NEKRP 642.34
506 VQHQFL 770.41
507 FLEAWV 763.39
508 GEVNVK 644.35
509 SACCPS 566.18
510 TSACCP 580.20
511 DERGDC 693.24
512 VYNHC 634.25
513 YNHCE 664.23
514 WNCTD 637.22
515 CKSEVE 693.30
516 GKCAS 464.20
517 APTCGL 560.26
518 PCALNP 613.29
519 NSMVLD 677.30
520 ILVEGG 586.33
521 HSACSP 600.23
522 NEMCQ 623.20
523 SKTYGL 667.35
524 AICQQD 676.28
525 SDMEVT 680.27
526 CNLTCR 708.30
527 LSVELH 696.38
528 TCHNNI 700.30
529 KGCSH 530.23
530 PSACEV 604.25
531 NAPILI 639.40
532 CEVARL 689.35
533 SHAYIG 646.31
534 SPVYAG 592.29
535 LLLGKA 613.42
536 CCPEY 613.19
537 APACQV 587.27
538 HCTNGS 617.22
539 ERASPP 655.33
540 KDETHF 775.35
541 AGYYK 600.29
542 ALERCP 687.34
543 KRSLSC 692.36
544 GHIFTF 720.36
545 LWEQC 677.28
546 PGTFRI 689.39
547 PYVGGN 605.28
548 LRISQK 743.46
549 CHQEQ 643.24
550 DELEQQ 760.32
551 VGSQWA 646.31
552 AGVAMD 562.24
553 CTMSG 497.16
554 FTFTPQN 853.40
555 CTGSST 554.20
556 LYVEDI 750.38
557 SVYLGE 666.32
558 YLRNC 667.31
559 ILVGNKG 699.43
560 ECMSM 599.17
561 EWRYN 766.34
562 EQWCE 693.24
563 DIHYC 649.25
564 CEERNLR 918.43
565 NDLTSS 635.28
566 TCQPD 562.21
567 CCSGEG 554.15
568 TGSPRG 573.29
569 PPVPHC 648.30
570 TLCPQS 647.29
571 LFVNGT 649.34
572 EVFIQQ 762.39
573 VSPTTL 616.34
574 NKAFVL 690.41
575 KRYPP 659.37
576 ESGRYII 836.44
577 NADQCC 652.19
578 VDAAAD 560.24
579 CQPIL 572.30
580 GSPRGD 587.27
581 TNGSVV 575.29
582 LDGSSRL 746.39
583 SSGEMQ 637.24
584 GTVTTD 592.27
585 RLRISQ 771.47
586 TTDWKT 750.35
587 TQCCD 568.16
588 ACQEPG 603.23
589 TCSTI 523.23
590 PVDFGNS 734.32
591 TLQDGC 635.26
592 FDGEVN 679.28
593 FAGYCS 646.24
594 IELFDG 692.34
595 VEGGEI 602.29
596 KTTCN 565.25
597 PLGYKEE 834.41
598 APVSPTT 671.35
599 LDVAFV 662.36
600 LTFDGL 664.34
601 AEFEVL 706.35
602 TNTGLA 575.29
603 CVSGCL 580.23
604 GSCKSE 609.24
605 EDISEP 688.29
606 EYECAC 716.21
607 ESTECP 664.24
608 AYAHV 559.27
609 GQSHFK 702.34
610 TCVCRD 695.27
611 EAEFEV 722.31
612 GGNRTN 617.29
613 CQEPGG 589.22
614 DIHLFV 742.40
615 VGPGLL 554.34
616 WKSVGS 662.34
617 LRDGTV 659.36
618 SKGLYL 679.39
619 PWNVVP 710.37
620 YGSITT 640.31
621 ACLEGC 594.21
622 CQICH 602.23
623 NTFDGS 639.25
624 QCGTP 504.20
625 NSWALS 676.32
626 AGKTCG 535.24
627 QEKVCG 662.31
628 LFQNKE 777.40
629 DGQNF 579.23
630 SGFKLE 679.35
631 SRNFVR 777.42
632 VPEEAC 646.26
633 NTGEC 522.17
634 EGCDV 521.18
635 NLTCEA 649.27
636 RSKEFM 796.39
637 IVSYLC 696.35
638 CGNFNI 666.28
639 TTLYVE 724.36
640 GPNANV 570.28
641 SGLAEP 572.28
642 PNANVQ 641.31
643 HIFTFTP 861.44
644 LVCPAD 616.29
645 SIIGDF 650.33
646 IEKQAP 684.38
647 KHSALS 641.35
648 SHPSVK 653.35
649 ISKANI 644.39
650 GLKDRK 715.43
651 EDLQMD 749.29
652 SCPPSL 602.27
653 TCACRK 680.31
654 LSYPDE 722.31
655 QHSDPC 685.25
656 YGWTD 640.25
657 HGAGVA 510.25
658 YPFSEA 712.31
659 VALHCT 642.32
660 SPPSCP 586.24
661 TFDGQN 680.28
662 LRQNAD 715.36
663 FAECHK 733.32
664 HRVNC 627.29
665 DSSPAT 576.24
666 KVPLDS 657.37
667 RSKRSL 745.46
668 DQCCPE 693.21
669 CSCSDG 570.14
670 TCSTIG 580.25
671 GALASY 580.29
672 QDLQKQ 758.39
673 PKAQC 545.26
674 NAWKL 630.35
675 CPQLEV 687.33
676 ILEEQC 733.33
677 DSNVVK 660.34
678 SQKWV 646.34
679 MYSFA 617.25
680 TNDCG 508.16
681 WKLHG 639.35
682 RNVSCP 674.32
683 KRVSPP 682.41
684 LKYTLF 783.45
685 FPIGIG 602.34
686 GFMHC 593.21
687 YDFANS 715.28
688 KAPTC 518.25
689 LDEGLC 648.28
690 PEGQLLD 770.38
691 MKSFAK 710.38
692 QRNVSC 705.32
693 PQLEVPV 780.44
694 GCSHPS 586.22
695 DVCTCT 640.22
696 SMGCVS 582.21
697 SYFDEM 790.28
698 QREGGP 642.31
699 DHSFSI 704.31
700 QNADQC 677.24
701 RMDVGQ 704.33
702 ETLQDG 661.29
703 VHRSTI 711.40
704 VTVLQY 721.40
705 VTWRT 661.35
706 TCQSLH 687.30
707 VMLEGS 634.30
708 CACPAL 576.24
709 RPGQTC 660.30
710 DEGLCV 634.26
711 QRMDVG 704.33
712 GSHAYI 646.31
713 PVCPSG 558.25
714 AQSKGD 604.28
715 EYECVC 744.25
716 PVCEVA 616.29
717 QSPVKV 656.39
718 TATLCPQ 732.35
719 LINECV 689.34
720 VPEKAH 679.36
721 KEEVFI 763.41
722 EIRYQG 764.38
723 CQSLHI 699.34
724 YHDGS 577.21
725 KVMLEG 675.36
726 CNKLVDP 787.39
727 VDSVDA 604.27
728 IVTFDG 650.33
729 KSFDNR 765.38
730 TRGRSS 662.35
731 EGSDKI 647.31
732 RFASGK 664.37
733 CPQSCE 665.21
734 LCPQSC 649.26
735 GWTDH 614.24
736 DLAPEA 614.29
737 PPDKVM 685.35
738 YAPGET 636.27
739 YDAAQL 679.32
740 IGIGDR 629.35
741 TVTTDW 721.33
742 YMVTG 569.25
743 HVCAQ 556.24
744 LDLVFLL 831.51
745 LLDLVF 718.43
746 VSLSVY 666.36
747 SEGCFC 644.19
748 EGTLTS 606.29
749 PCFHQ 630.26
750 GKEYAP 663.32
751 DRKWN 717.36
752 RKWNC 705.34
753 TTTCLP 634.30
754 AHCPP 523.22
755 VAFVLE 676.38
756 DAPVSPT 685.33
757 TCVDPE 662.26
758 PDHQPC 695.27
759 LCDLAP 630.30
760 ISGFKL 663.40
761 EFEVLKAFVV 1179.65
762 PLSHRS 695.37
763 CRCER 665.27
764 CFCPPD 680.23
765 WVPDHQ 780.35
766 KWNCT 650.28
767 SGRKVN 659.37
768 ASYAAA 552.25
769 TCLSGR 635.31
770 ASKGLY 637.34
771 PTDAPV 598.30
772 ALGFAV 576.33
773 GSITTI 590.33
774 DIQLPL 697.40
775 HPSVKC 669.33
776 DPVSCD 634.23
777 GLECTK 649.31
778 YRQCV 667.31
779 MEEVIQR 903.45
780 VRFNH 671.35
781 HEVRFN 800.39
782 FKLEC 638.31
783 GEGLQI 615.32
784 HCQVLL 711.37
785 GPRLTQ 670.38
786 QRVREI 799.47
787 ECPGEC 636.19
788 SCCSPT 596.19
789 CEKTLC 695.30
790 PYDFAN 725.30
791 RTCAQE 706.31
792 QEGMVL 675.33
793 GYLAST 610.30
794 QTYQEK 795.38
795 QCSCCS 629.16
796 CVESTE 666.25
797 YMDERG 769.31
798 KVCGLCGNFD 1054.46
799 MECKC 612.21
800 AVVEYH 716.35
801 RAEGLE 673.34
802 TARCSL 649.32
803 NVSCPQLEVPV 1183.59
804 LAEGGK 573.31
805 RVNCD 605.26
806 AGDSNV 561.24
807 IDRPEAS 786.39
808 ENNTGE 662.25
809 CLEGCF 670.24
810 GYECE 599.19
811 RPSCPN 672.30
812 LPPHMA 664.34
813 WEKRVT 817.44
814 NANVQE 673.30
815 GVRVAW 686.39
816 LKDRKR 814.51
817 NVVKLQ 699.43
818 ISQKW 660.36
819 CIGEDG 592.22
820 MDGQDI 677.27
821 TLPPHM 694.35
822 TEAGYY 702.29
823 VRVAVVE 770.46
824 DWDGRG 704.29
825 CGCRW 623.23
826 CERMEAC 840.29
827 GICDEN 649.24
828 QVCEVI 689.34
829 LVPDSS 616.31
830 FNRSKE 779.39
831 YKLSGE 695.35
832 PARFAG 617.33
833 KKRVTI 743.50
834 PEYECV 738.29
835 WEEGC 622.21
836 DHPSEG 640.24
837 KTCQN 592.26
838 GNFNIF 710.34
839 CSYVLF 730.34
840 PEPYLD 732.33
841 ILIQDF 747.42
842 VTVFPI 674.40
843 VTILVE 672.41
844 SLVKLK 686.47
845 SQEPQR 743.36
846 PDGQTL 629.30
847 PPSCPP 596.26
848 VDVMQR 746.37
849 GPKRNS 657.36
850 HRLPTL 735.44
851 QCPCYY 775.27
852 ICQQDS 692.28
853 FGNAW 593.26
854 DWKTLV 760.41
855 QLSPKT 672.38
856 GLHNSL 639.33
857 ITARLQ 700.42
858 SIGDCA 564.22
859 LEGCFC 670.24
860 DGSHAY 648.25
861 TQPCPT 645.28
862 LEAWVP 713.37
863 SQCAD 522.17
864 IRYQGG 692.36
865 TDAPVSP 685.33
866 ASQVKY 694.36
867 MLEGSC 638.24
868 CVALER 689.35
869 PPGMVR 655.35
870 DITARL 687.39
871 TVRLPG 641.39
872 SCPEGQ 619.23
873 SGEGLQ 589.27
874 CQHPE 612.23
875 MKQTM 637.29
876 YLQCG 582.25
877 SSSFPAS 681.30
878 QQRNVS 730.37
879 RMSRN 662.33
880 MAQVTV 647.33
881 GNKGCS 564.23
882 ALALILP 709.47
883 IVIPVG 596.39
884 EGGEIE 632.26
885 TCEACQ 653.21
886 GEQWC 621.22
887 DGIQNN 659.29
888 GLCVEST 707.32
889 ECLCGA 594.21
890 YCGSNP 639.23
891 PCNLTC 649.26
892 AGRRFA 676.38
893 VLQYGS 665.34
894 AQCSQK 663.30
895 PEPLAC 628.29
896 SLSRDC 679.30
897 SSCRIL 677.35
898 VDSSCR 665.28
899 LQKQHS 739.40
900 ALSVVW 673.38
901 KSHRVN 739.41
902 DGCSCP 580.16
903 DEDGNE 677.21
904 QCADD 550.17
905 CDLPPVP 739.36
906 SFDNRY 800.34
907 TLRKTQ 745.44
908 DNRYFT 814.36
909 RCMVQV 734.36
910 TARLQY 750.40
911 LKSTSV 633.37
912 EPFVAL 674.36
913 FSDHHT 742.30
914 CNTCVC 641.20
915 LHEGEC 686.27
916 RLSEAEF 850.42
917 QEKVCGLCGNF 1196.53
918 QHPEPLA 790.40
919 LLARDC 689.35
920 TASVRL 645.38
921 VPDSSH 640.28
922 HAYIGL 672.36
923 VASTSE 592.27
924 KQAPEN 685.34
925 CPPGKI 613.33
926 QIRLIE 770.46
927 QWICS 635.27
928 FEVVES 708.33
929 SGKRYP 706.38
930 HTVTAS 614.30
931 EDGFM 597.21
932 ECNEAC 667.19
933 VNERGE 702.33
934 TLPDQC 675.29
935 PEAPPPT 707.35
936 GRLLVK 684.46
937 ELRRIAS 843.49
938 SFAGYC 646.24
939 MDERGD 721.27
940 VSQGDR 660.32
941 MQREG 619.27
942 DLEVIL 700.40
943 DQCSCC 657.16
944 QDSCH 588.20
945 KTYGLC 683.33
946 QKQHSD 741.34
947 VCIYD 611.26
948 GLRPSC 631.31
949 CRYDV 654.28
950 GGPSQI 557.28
951 VQRPGQ 683.37
952 DLPTM 575.26
953 LCEVAR 689.35
954 FRILVG 703.44
955 VDGCSC 582.18
956 NIFAED 707.31
957 QWCER 720.30
958 QSLHIN 710.37
959 EPGRCE 689.28
960 QYSYM 690.27
961 PEPFVA 658.33
962 NGRLVS 644.36
963 TVFPIG 632.35
964 LHINE 624.32
965 FNKTCGL 781.38
966 EGGPSQ 573.24
967 EDCPVC 664.22
968 LTSSNL 633.33
969 ECVRVK 732.39
970 LVFLLDGS 862.48
971 CQNYDL 754.30
972 HHTMC 627.23
973 DPEDCP 674.22
974 LLDEGL 658.35
975 RTNGVC 648.30
976 TGSSTR 607.29
977 PEKAHL 693.38
978 HANLKQ 709.39
979 VESTEC 666.25
980 RASPPSS 700.35
981 SPVKVE 657.37
982 VSVLQY 707.38
983 ARLQYV 748.42
984 VVPIGV 582.37
985 EPPLHD 706.33
986 PLHDFY 790.36
987 YFTFSG 720.31
988 QICTC 566.22
989 SALSVEL 717.39
990 VGNKGC 576.27
991 DCPVCE 664.22
992 SNEECP 677.23
993 YHEVLN 773.37
994 IASYAH 660.32
995 SGFTYV 672.31
996 YDGEIF 742.32
997 SQWIC 635.27
998 PAGMEY 666.27
999 SSHCQV 659.27
1000 NSQWI 646.31
1001 KVEETC 707.32
1002 PLGYLA 632.35
1003 VWDRH 711.34
1004 VKLQRI 755.50
1005 TGECCG 568.16
1006 FHQGKE 744.35
1007 KTLCEC 695.30
1008 LSYGEDL 795.36
1009 DVCIY 611.26
1010 PDSSHC 644.22
1011 DSSHCQ 675.23
1012 RHLSIS 711.40
1013 LSVVWD 717.37
1014 DRHLSI 739.40
1015 VKHSAL 653.39
1016 FQIFSK 768.42
1017 KVVTWR 787.47
1018 CPCVCT 624.21
1019 PACQVT 617.28
1020 DCNTCI 667.23
1021 SPAPDC 588.22
1022 EYHDG 619.22
1023 PKTFAS 649.34
1024 KLQRIE 785.48
1025 CPSCRC 667.22
1026 FCAMS 557.20
1027 LPDQCH 711.30
1028 YQEKVC 768.35
1029 GTLCAE 592.25
1030 GDILQRV 799.45
1031 IALLLM 672.42
1032 KWVRVA 757.46
1033 LLVKLS 671.46
1034 LHGDCQ 671.27
1035 GQTCQ 535.21
1036 PHRLPT 719.41
1037 QFWEE 737.30
1038 PATCH 527.22
1039 EDGNEK 690.28
1040 LTNPGE 629.30
1041 PDKVCV 659.33
1042 CPTAK 518.25
1043 EQDLEV 731.33
1044 FVNGTV 635.33
1045 VNVKRP 711.44
1046 TLGPKR 670.41
1047 PTLRKT 714.44
1048 TCQNY 627.23
1049 HLCRTN 742.35
1050 DGLKYLF 854.45
1051 RLLDLVF 874.53
1052 NEACLE 677.27
1053 AKAPTC 589.29
1054 YYKLSG 729.37
1055 TGSCSY 616.22
1056 VTQGDQ 646.29
1057 NVKRPM 743.41
1058 EQCQLL 732.35
1059 PSCPPH 636.27
1060 GGQIMT 605.28
1061 CTCTDM 672.19
1062 SSNLQV 646.33
1063 FVALCE 680.32
1064 VSGCLC 580.23
1065 EVDIHY 774.35
1066 WDGRGR 745.36
1067 KTFASK 680.39
1068 CVRVKE 732.39
1069 LKRDET 760.41
1070 GGLVVPP 637.38
1071 RLPTLRK 882.58
1072 NERGEY 766.32
1073 AWREPG 714.34
1074 LGPKRN 683.41
1075 TCPCV 521.20
1076 SYVLFQ 755.38
1077 GSVVYH 660.32
1078 AGRGVR 614.36
1079 RMEACM 739.28
1080 IQDFET 751.34
1081 FAEDDF 742.28
1082 YHDGSHAYIGL 1231.56
1083 ETHFEV 760.34
1084 YSYMVT 762.33
1085 KGLWEQ 759.39
1086 FNHLGH 723.34
1087 YLTFDGLKYL 1231.65
1088 FSKIDR 764.42
1089 QMDWD 693.24
1090 LRRIASQVKY 1232.73
1091 FQPEDI 747.34
1092 FPASYF 730.33
1093 MTLKR 647.38
1094 RLPGLH 691.41
1095 DAARSN 632.29
1096 GKRVSL 658.41
1097 LETEAG 618.29
1098 TDWKTL 762.39
1099 KVTLNP 670.40
1100 DPCALN 631.26
1101 NNEFQ 650.27
1102 FDIHLF 790.40
1103 YVQGLK 706.40
1104 RIALLL 697.48
1105 TVLQYS 709.36
1106 AGPAGDS 573.24
1107 PEASRIA 742.40
1108 DFCAM 585.19
1109 MEACML 696.26
1110 HQFLEAW 929.44
1111 AWVPDH 723.33
1112 IGWPN 585.29
1113 RKRPSEL 884.52
1114 EADFNR 750.33
1115 EYFWE 772.31
1116 GLYLET 694.35
1117 GSMYSF 690.27
1118 PQNNEF 747.32
1119 RFNHLG 742.39
1120 VREIRY 834.47
1121 GLKKKK 700.50
1122 CLVTGQS 706.33
1123 SLSVYLG 737.40
1124 CVPEEA 646.26
1125 CVDGCS 582.18
1126 HYLTFDGLKY 1255.62
1127 CSGFVR 667.31
1128 VYLGEF 726.36
1129 VAWREP 756.39
1130 LLDGSSR 746.39
1131 CDLAPE 646.26
1132 DENGAN 618.22
1133 YLCDLA 696.31
1134 ENRCVA 690.31
1135 IGPHA 493.26
1136 KIGCN 533.26
1137 SCAPAC 550.19
1138 IGVGPN 555.30
1139 SEMHG 559.21
1140 GNPASD 559.22
1141 NGTVIG 559.30
1142 NVSSCG 565.22
1143 GNVSSC 565.22
1144 VSSCGD 566.20
1145 KHGAGV 567.31
1146 CHAHC 569.18
1147 VIGPGK 569.35
1148 VGPNAN 570.28
1149 IGPGKT 571.33
1150 QTCQP 575.24
1151 VQCVE 576.26
1152 DGNVSS 577.23
1153 CTNGSV 579.23
1154 IGDCAC 580.20
1155 PNFTC 580.23
1156 LKHGAG 581.33
1157 SYAAAC 584.23
1158 RHCDG 586.23
1159 ACPALL 586.31
1160 CSPGAR 589.26
1161 SQIGDA 589.27
1162 GDSNVV 589.27
1163 GARQGC 590.26
1164 TMSGVP 590.27
1165 CAPACQ 591.21
1166 YAHVC 591.25
1167 ECACPA 592.20
1168 CDTIAA 592.25
1169 YLLAGG 592.32
1170 CDGNVS 593.21
1171 RQGCM 593.24
1172 GCSCPE 594.18
1173 GLECAC 594.21
1174 TCICR 594.26
1175 ALASYA 594.30
1176 GCNTCV 595.21
1177 VIPVGI 596.39
1178 LAGPAGD 599.29
1179 QICHC 602.23
1180 HCQIC 602.23
1181 AMSCPP 604.23
1182 LPTACT 604.29
1183 CEVVTG 606.27
1184 SACEVV 606.27
1185 KCASKA 606.32
1186 STATND 607.24
1187 CICRN 607.26
1188 SSSCNI 609.24
1189 SCNISS 609.24
1190 NSTVSC 609.24
1191 CASKAM 609.26
1192 CSTIGM 610.24
1193 KTSACC 611.24
1194 CKTSAC 611.24
1195 QVVPIG 611.36
1196 VCAQHG 613.26
1197 VEGCHA 614.25
1198 PSQIGD 615.29
1199 PCPTAK 615.30
1200 GVPGSL 528.29
1201 LNGTVI 615.36
1202 GPAGDSN 616.24
1203 LCPPGM 616.27
1204 SPRGDS 617.28
1205 MVTGNP 617.28
1206 KIPGTC 617.32
1207 VARIDG 629.35
1208 KLVCPA 629.36
1209 CMSMGC 630.16
1210 DCVPKA 631.30
1211 GRCLPS 631.31
1212 DKIGEA 631.32
1213 PGKTVM 631.34
1214 KIMKI 631.41
1215 GGKIMK 632.37
1216 LCGALAS 633.32
1217 MLNGTV 633.32
1218 EGGKIM 633.32
1219 PVYAGK 633.35
1220 LECACP 634.24
1221 GCPPF 519.21
1222 THFCK 634.29
1223 DLTSSN 635.28
1224 TACTIQ 635.29
1225 NCVNST 636.25
1226 CAQEGM 637.22
1227 FMHCT 637.23
1228 GSDFVN 637.27
1229 HCPPGK 637.30
1230 VYAGKT 637.34
1231 YVGGNM 639.27
1232 DVCTTC 640.22
1233 CSCESI 640.22
1234 VCTCTD 640.22
1235 PTLTNP 641.34
1236 PGKILD 641.37
1237 PGLLGVS 641.37
1238 CAQHGK 642.29
1239 LRGGQI 642.38
1240 LHCTNG 643.27
1241 GSSTRH 643.30
1242 CPCVHS 644.24
1243 HVCDAT 644.26
1244 QPDGQT 644.28
1245 AAADAAR 644.32
1246 CVPKAQ 644.33
1247 IAAYAH 644.33
1248 TTIDVP 644.34
1249 VFPIGI 644.39
1250 SPENPC 645.24
1251 CNPCPL 645.26
1252 GCLCPPG 645.26
1253 TTQPCP 645.28
1254 NCPKGQ 645.29
1255 RCLPSA 645.33
1256 MKIPGT 645.35
1257 LGVSTLG 645.37
1258 LLGVST 588.35
1259 CQPDGQ 646.24
1260 YCSYL 647.26
1261 CPVQC 548.21
1262 TVTCQP 647.29
1263 QEGTLT 647.31
1264 PSGFQL 647.33
1265 ACTIQL 647.33
1266 GKTVMI 647.37
1267 QCIGE 548.23
1268 ETVQCA 649.27
1269 CLCGAL 578.26
1270 GDALGF 578.27
1271 LPGLHN 649.35
1272 EGLECT 650.26
1273 IDVCTT 650.29
1274 KVSSQC 650.31
1275 AGGLEC 548.23
1276 RCVDGC 651.25
1277 YNGNQG 651.26
1278 SCKSEV 651.29
1279 VNTFDG 651.29
1280 PVGIGP 538.31
1281 GCHAH 523.20
1282 TPDFCA 652.25
1283 DTIAAY 652.31
1284 VYGAIM 652.32
1285 KLKHGA 652.40
1286 RCCSGE 653.23
1287 CCGRCL 653.24
1288 FSGICQ 653.28
1289 SMPYAS 654.27
1290 QHTVTA 655.33
1291 EGLQIP 655.35
1292 AGVLLAL 655.43
1293 TFDGSM 656.25
1294 QVTVGPG 656.35
1295 DYCGSN 657.21
1296 ALHCTN 657.29
1297 QLRGGQ 657.36
1298 VKLVCP 657.39
1299 RCLPTA 659.34
1300 CACFCD 660.17
1301 RGGQIM 660.34
1302 RTNTGL 660.35
1303 ITTIDV 660.37
1304 ADDRDA 661.27
1305 DCSQPL 661.27
1306 GNRTNT 661.31
1307 NRTNTG 661.31
1308 CDVVNL 661.31
1309 LGFAVR 661.39
1310 RFAGVL 661.39
1311 EECPGE 662.22
1312 AGYCSY 662.24
1313 GNMEVN 662.27
1314 NCTTQP 662.27
1315 IHYCQ 662.28
1316 RVAQCS 662.32
1317 CLSGRK 662.35
1318 RGRSST 662.35
1319 SPPSSSC 663.25
1320 RDAVCT 663.30
1321 CSPTRT 663.30
1322 DAVCTR 663.30
1323 VCTRSV 663.34
1324 EYAPGE 664.27
1325 CSQKPC 664.27
1326 VNCTTQ 664.28
1327 CPLGYL 664.32
1328 KVNCTT 664.32
1329 LTSPTF 664.34
1330 QVKYAG 664.35
1331 ACSPVC 578.22
1332 CCSPTR 665.26
1333 MTQEGT 665.27
1334 CTRSVT 665.32
1335 QYGSIT 667.32
1336 MHGARP 667.32
1337 IQVVPI 667.43
1338 ECCGRC 669.20
1339 NCRYD 669.25
1340 SKAMY 598.28
1341 QVALHC 669.33
1342 EPGGLVV 669.37
1343 DIQVVP 669.37
1344 RLVSVP 669.42
1345 FGSDFV 670.30
1346 GCPRHC 671.26
1347 KLHGDC 671.31
1348 SPGARQG 671.33
1349 LSCRPP 671.34
1350 QPTLTN 672.34
1351 CALNPR 672.34
1352 IVIETV 672.41
1353 PVCPAGM 673.29
1354 EPMQVA 673.31
1355 LPDKVC 673.35
1356 CLPDKV 673.35
1357 VMGLRV 673.39
1358 IPARFA 673.39
1359 NPGECR 674.28
1360 GECRPN 674.28
1361 GDREQA 674.30
1362 EGTRGR 674.35
1363 EACQEP 675.25
1364 SIDIND 675.31
1365 TCLPDK 675.33
1366 GRKVNC 675.35
1367 APNLVY 675.36
1368 CTDHVC 676.23
1369 CVDPED 676.24
1370 GVAMDG 548.23
1371 LASTATN 676.34
1372 TVMIDV 676.35
1373 RSSTAR 676.36
1374 LVSVPY 676.38
1375 CELNCP 677.25
1376 ECAGGL 548.23
1377 KPCEDS 677.27
1378 DRDAVC 677.28
1379 ERCVDG 677.28
1380 LMASQE 677.30
1381 GECLVT 620.28
1382 VNLTCE 677.30
1383 KAFVVD 677.37
1384 SGFVRI 677.39
1385 MDEDGN 679.21
1386 EEACTQ 679.25
1387 RECLCG 679.28
1388 QTMVDS 679.28
1389 GRECLC 679.28
1390 DSSCRI 679.30
1391 PPHMAQ 679.31
1392 GIGDRY 679.33
1393 LQYGSI 679.35
1394 TSVFAR 679.36
1395 TDMEDA 680.23
1396 CQVTCQ 680.26
1397 PSDPEH 680.28
1398 TSPTFE 680.30
1399 AFVVDM 680.32
1400 VCTTCR 681.29
1401 RCSLFG 681.33
1402 SVFARC 681.33
1403 PHMAQV 681.33
1404 CSNEEC 683.19
1405 EDGVQH 683.29
1406 EAYGFV 684.31
1407 PADNLR 684.35
1408 KRLPGD 684.39
1409 RGLRPS 684.40
1410 HCDVVN 685.28
1411 EACHRA 685.30
1412 HMAQVT 685.32
1413 SHCQVL 685.32
1414 PLDSSPA 685.33
1415 QRPGQT 685.35
1416 SKANIG 588.32
1417 ARPGASK 685.39
1418 RPGASKA 685.39
1419 SDPEHC 686.23
1420 ASKAVVI 686.43
1421 NCTDH 588.20
1422 HTVTCQ 687.30
1423 VVTGSP 558.30
1424 DAVLSSP 687.34
1425 PDAVLSS 687.34
1426 VIETVQ 687.38
1427 DDRDAV 689.30
1428 QCSQKP 689.32
1429 GTLTSDP 689.32
1430 SPTRTE 689.33
1431 ASGKKVT 689.41
1432 GRCELN 690.31
1433 YGAIMH 690.32
1434 PKGQVY 690.37
1435 PQSCEE 691.25
1436 DGRECL 691.30
1437 IETVQC 691.32
1438 PSLVYN 691.35
1439 CRILTS 691.37
1440 MVKLVC 691.38
1441 SYAHLC 692.29
1442 DMEVTV 692.30
1443 CKCSPR 692.31
1444 IGDFQN 692.31
1445 FDGIQN 692.31
1446 CSPRKC 692.31
1447 RRFASG 692.37
1448 GRRFAS 692.37
1449 EECNEA 693.23
1450 CADDRD 693.24
1451 ICSNEE 693.26
1452 PSCRCE 693.26
1453 CLINEC 693.28
1454 QGDDFL 693.30
1455 YQGGNR 693.32
1456 RYQGGN 693.32
1457 LECTKT 693.34
1458 NQGDDF 694.26
1459 MEDAVM 694.27
1460 SRDCNT 694.27
1461 NTCVCR 694.29
1462 LTSDPY 694.32
1463 YAGSQV 623.29
1464 QGKEYA 694.33
1465 SQVKYA 694.36
1466 GTCCDT 598.17
1467 EDSCRS 695.25
1468 CPPHR 608.28
1469 ARCSLF 695.34
1470 VPPTDAP 695.35
1471 PGMVRH 695.35
1472 PPTDAPV 695.35
1473 ARCHPL 695.35
1474 WPNAPI 696.36
1475 HGCPR 568.25
1476 MQVALH 697.36
1477 VVPPTD 626.33
1478 IQHTVT 697.38
1479 IPTLSP 626.36
1480 PDQCHT 699.26
1481 TLSPAPD 699.34
1482 DKVCVH 699.34
1483 HKCLAE 699.34
1484 PTRTEP 699.35
1485 REAPDL 699.35
1486 AHLCRT 699.35
1487 LHKLCS 699.37
1488 YCQGKC 700.27
1489 EKRPGD 700.35
1490 ALNPRM 700.37
1491 VQVGVIS 700.41
1492 ECACN 538.15
1493 DQCHTV 701.28
1494 PDKVML 701.38
1495 VLSSPLS 701.40
1496 WASPEN 702.30
1497 GETVKIG 702.39
1498 KSIEVK 702.43
1499 QNNDLT 703.31
1500 TQGDQR 703.32
1501 RILTSD 703.39
1502 NMEVNV 704.32
1503 CERGLQ 704.33
1504 LARDCQ 704.33
1505 PENKAF 704.35
1506 PALLEY 704.37
1507 VAGRRF 704.41
1508 EPECND 705.23
1509 VCPAGME 705.28
1510 FCPPDK 705.32
1511 EAQSKG 618.30
1512 TVSCPL 618.30
1513 ASTSEVL 705.35
1514 MKSIEV 705.37
1515 LCEKTL 705.37
1516 GQNFKL 705.38
1517 KLSPVY 705.41
1518 TCEEPE 706.25
1519 DVQDQC 706.26
1520 YSFAGY 706.30
1521 LSRDCN 706.31
1522 WALSSG 619.30
1523 RTCQSL 706.34
1524 GEIELF 706.35
1525 ENKAFV 706.36
1526 GQVYLQ 706.36
1527 FSIVIE 706.39
1528 KGQVYL 706.40
1529 SEEACA 608.21
1530 DFQNGK 707.32
1531 ACNCVN 622.22
1532 SDVFQD 709.29
1533 CQYLLA 709.35
1534 EKAHLL 709.41
1535 RDCNTC 710.25
1536 CRKTTC 710.32
1537 EGMVLY 710.33
1538 RNCRY 710.33
1539 CEDSCR 711.23
1540 FMTQEG 711.29
1541 YGFVAR 711.37
1542 SIEVKH 711.39
1543 IEVKHS 711.39
1544 TRHIV 624.37
1545 SYLCDL 712.31
1546 QDIQLP 712.38
1547 VPWNVV 712.39
1548 DRGLRP 712.40
1549 QLRILA 712.46
1550 HCERGL 713.33
1551 REQAPN 713.35
1552 VPLDSSP 713.36
1553 LPDAVLS 713.40
1554 SLLPDAV 713.40
1555 GRGVRVA 713.43
1556 AVVILVT 713.47
1557 DREQAP 714.33
1558 GVQHQF 714.34
1559 DTRKVP 714.40
1560 STIGMA 578.27
1561 FASKTY 715.35
1562 ILPGTLC 715.39
1563 CIYDTC 716.25
1564 PAPDCS 588.22
1565 APDCSQ 619.23
1566 TFYAIC 716.32
1567 REPGRC 716.34
1568 DHSFLV 716.35
1569 PGTSLSR 716.38
1570 RSVTVR 716.43
1571 DSCHQ 588.20
1572 NDVQDQ 717.29
1573 DGNEKR 717.34
1574 NGTVTQ 618.30
1575 PRKCSK 717.40
1576 KCSPRK 717.40
1577 PRHCD 626.26
1578 TIDVPW 729.37
1579 DVWTLP 729.37
1580 VWTLPD 729.37
1581 LSISVVL 729.46
1582 YECVCD 730.23
1583 HNNIM 627.28
1584 ELHSDM 730.30
1585 RQNADQ 730.34
1586 NVQELE 730.35
1587 LVLQRC 730.42
1588 SLVYNH 731.36
1589 RSNRVT 731.40
1590 QCQLLK 731.40
1591 SGKKVTL 731.45
1592 DVGQDS 619.24
1593 QSHFKS 732.35
1594 VSPCART 732.36
1595 TVTASVR 732.41
1596 NFQVLL 732.42
1597 EEACAVL 733.33
1598 TRTEPM 733.34
1599 VTDVSVD 733.35
1600 YPPGTSL 733.36
1601 DKVMLE 733.37
1602 KRNSMV 733.39
1603 MIPARF 733.39
1604 QEQVCE 734.29
1605 VAMDGQ 619.26
1606 HYCQGK 734.32
1607 CVSPCA 578.22
1608 DQRVSM 734.34
1609 MAHYLT 734.34
1610 EPYLDV 734.35
1611 TMVTLG 620.32
1612 RYVQGL 734.41
1613 HKVLAPA 734.44
1614 CQDHSF 735.26
1615 GEMQKG 648.29
1616 FLTPSG 620.32
1617 VRICMD 735.34
1618 NLVYM 638.31
1619 TIYPVG 648.35
1620 VLVQDY 735.38
1621 RSTIYP 735.39
1622 ISSGEM 622.26
1623 CRPNFT 736.33
1624 ECRKTT 736.35
1625 IGDRYD 737.33
1626 VLYGWT 737.37
1627 AQHGKV 638.35
1628 LVQDYC 739.32
1629 PATFYA 668.32
1630 LSSPLSH 739.39
1631 ANIGPR 626.35
1632 LLPDAVL 739.45
1633 SGFQLSC 740.32
1634 MYSID 627.26
1635 VEYPFS 740.34
1636 LVTGQSH 740.38
1637 GLAEPRV 740.42
1638 GLQIPT 627.36
1639 CTTTTC 628.22
1640 HSDPCA 628.23
1641 FVNTFD 741.33
1642 HSALSVE 741.37
1643 IHLFVN 741.42
1644 VILLLDG 741.46
1645 HQEQVC 742.31
1646 WNVVPE 742.36
1647 TCSCES 628.18
1648 FYAICQ 743.33
1649 DEHKCL 743.33
1650 EPRVED 743.34
1651 NTGLALR 743.43
1652 EVNVKR 743.43
1653 SFLHKL 743.43
1654 VVYHEV 744.38
1655 NSFLHK 744.39
1656 MVQVGVI 744.42
1657 SISVVLK 744.47
1658 HINEMC 745.29
1659 LRVAQC 688.37
1660 ILVTDVS 745.42
1661 NNIMKQ 746.37
1662 VLEGSD 618.29
1663 HSGKRY 746.38
1664 IFQPED 747.34
1665 CKVNER 747.37
1666 LRKTQC 747.41
1667 WICSN 621.26
1668 CVCRDR 750.33
1669 VNVYGA 621.31
1670 AHYLTF 750.37
1671 KAFVLSS 750.43
1672 EGCFCPP 751.27
1673 CGICDE 638.20
1674 VIASYA 622.33
1675 EYART 638.30
1676 EVLKYT 751.41
1677 QVYLQC 752.35
1678 FQDCN 625.22
1679 ECQYVL 753.34
1680 MEVNVY 753.34
1681 IFSDHH 754.34
1682 APDLVLQ 754.42
1683 KANIGP 598.34
1684 PLLKGDL 754.46
1685 EIKRLP 754.47
1686 NYDLEC 755.28
1687 DEMKSF 755.32
1688 LEVPVC 658.34
1689 EDDFMT 756.26
1690 ERIGWP 756.39
1691 RLRQNA 756.43
1692 ARLRQN 756.43
1693 PPTLPPH 757.41
1694 TVNGRLV 757.44
1695 PLPYLR 757.45
1696 VKRPMK 757.46
1697 LLSLVDV 757.46
1698 VILVTDV 757.46
1699 DHVCDA 658.24
1700 QKGLWE 759.39
1701 KRVTGCP 759.41
1702 FLHKLC 759.41
1703 CDEYEC 760.20
1704 QNKEQD 760.33
1705 HQGKEY 760.35
1706 KEQDLE 760.36
1707 IQRMDV 760.39
1708 TLKRDE 760.41
1709 KRDETL 760.41
1710 VKCKKR 760.47
1711 FEACHR 761.33
1712 EIFQPE 761.36
1713 PRVEDF 761.37
1714 LSSVDEL 761.38
1715 MQKGLW 761.39
1716 DPVDFG 648.27
1717 QYLLAR 762.44
1718 AKAFISK 763.46
1719 ECRPNF 764.33
1720 DSQSSW 708.27
1721 RICMDE 765.31
1722 FVLSSVD 765.39
1723 LVDPEP 668.34
1724 CRKEEC 766.31
1725 GDRYDAA 766.32
1726 LSGEAY 638.29
1727 VIVIPV 638.44
1728 MVLYGW 767.37
1729 QLPLLKG 767.49
1730 FWEEGC 769.27
1731 MTRFSE 769.34
1732 SHRSKR 769.43
1733 GRGRLLV 769.49
1734 DSCRSG 623.23
1735 EYPFSE 770.31
1736 SVTVRLP 770.46
1737 NLKQIR 770.48
1738 SLFGSDF 771.34
1739 PFDEHK 771.35
1740 VLQYSY 771.38
1741 YDLECM 772.28
1742 NGKRVSL 772.46
1743 DNLRAEG 773.37
1744 PQRMSR 773.40
1745 LPPVPH 658.38
1746 KRPMKD 773.42
1747 WKTLVQ 773.44
1748 ERGDCVP 774.33
1749 YLGEFF 774.36
1750 TLVQEW 774.39
1751 LPYLRN 774.44
1752 YDVCSC 688.22
1753 HPSEGC 628.23
1754 HRSTIY 775.40
1755 LSLVDVM 775.41
1756 QLLKSTS 775.44
1757 KLECRK 775.44
1758 DETHFE 776.30
1759 DVMQRE 776.35
1760 EFQLQL 776.41
1761 FDEHKC 777.31
1762 SSVDELE 777.34
1763 SQCADTR 779.32
1764 QNYDLE 780.33
1765 DLRIQH 780.42
1766 KAHLLSL 780.49
1767 AAACAGR 618.29
1768 FQLSCK 724.36
1769 LAPATF 618.34
1770 EFMEEV 782.32
1771 YVLFQN 782.40
1772 CEVIAS 620.28
1773 IMHEV 627.30
1774 AAQLRIL 783.50
1775 MVRHEN 784.36
1776 CQVLLLP 784.45
1777 EDISEPP 785.34
1778 SVELHSD 785.36
1779 WTVQRP 785.42
1780 DGRGRLL 785.45
1781 VRVAWR 785.47
1782 ISVVLKQ 785.50
1783 FYCSRL 787.37
1784 ADNLRAE 787.38
1785 KRVSLS 688.42
1786 DFYCSR 789.31
1787 QEWTVQ 789.37
1788 SEVEVDI 789.38
1789 VFIQQR 789.45
1790 LAPEAPPP 790.42
1791 NDITAR 688.35
1792 RKEECK 791.40
1793 EKRVTG 688.39
1794 CRNSQW 792.33
1795 FQNKEQ 792.38
1796 TGLALRY 792.45
1797 DFLTPS 678.32
1798 EMCQER 794.30
1799 DFMLRD 795.36
1800 KQTYQE 795.38
1801 KKVIVI 698.50
1802 RMTRFS 796.40
1803 ERGEYF 799.35
1804 WREPGR 799.41
1805 PRLTQVS 799.45
1806 DVILLLD 799.47
1807 PVKVEET 800.43
1808 RLTQVSV 801.47
1809 EGQLLDE 802.37
1810 EQQRDE 803.34
1811 NRCVALE 803.40
1812 KSEVEVD 804.39
1813 FIQQRN 804.42
1814 GTFRILV 804.49
1815 GLALRYL 804.49
1816 DGSMYS 658.23
1817 QKPCED 718.30
1818 WEQCQL 805.34
1819 HPLVDPE 805.40
1820 PRMTRF 806.42
1821 QNFKLTG 806.43
1822 ELFDGE 708.30
1823 VRHENR 809.43
1824 HNSLVKL 809.48
1825 YGEDLQ 723.31
1826 FVRYVQ 810.44
1827 ECTKTCQ 811.32
1828 KEFMEE 811.34
1829 WDRHL 725.36
1830 QLQLSPK 812.48
1831 NKLVDPE 813.42
1832 LLKGDLR 813.51
1833 ETLPREA 814.42
1834 QKWVRV 814.48
1835 PLFAECH 815.36
1836 RVAWRE 815.44
1837 MERLRI 816.46
1838 SNLQVE 688.34
1839 MHEVRF 817.39
1840 EWTVQR 817.41
1841 CKRVSP 688.37
1842 ASDEIKR 817.43
1843 DRPEASR 829.40
1844 NECVRV 718.34
1845 FQLQLSP 831.45
1846 NRVTVFP 831.46
1847 EEQCLV 719.32
1848 SVDSVD 620.26
1849 GSNPGTF 678.30
1850 MMERLR 834.42
1851 ALLEYAR 834.46
1852 RVAVVEY 834.46
1853 ALRYLS 721.41
1854 FTYVLH 778.40
1855 GLKYLFP 836.48
1856 CACRKE 708.30
1857 RYDAAQ 722.33
1858 GNFDGI 621.28
1859 LYLETEA 837.41
1860 DEIVSY 724.33
1861 HQPCQI 724.33
1862 PDLVLQR 839.49
1863 PEHCQI 725.32
1864 YGLCGIC 727.30
1865 KILDELL 842.51
1866 QELERIG 843.44
1867 SELRRIA 843.49
1868 NLQVEED 845.38
1869 HFEVVE 758.36
1870 ALLLMASQ 845.47
1871 NRYFTF 846.40
1872 EEDPVDF 849.34
1873 GYKEEN 738.32
1874 CQYVLV 723.36
1875 KYLFPGE 852.44
1876 YVEDISE 853.37
1877 RNFVRY 853.46
1878 TLLKSHR 853.51
1879 QPILEE 727.37
1880 PNSQSPV 727.35
1881 LKKKKVI 855.63
1882 RGEYFW 856.39
1883 RPGDVW 728.36
1884 RLIEKQA 856.51
1885 RNLRENG 857.45
1886 VRVKEEV 857.50
1887 SDEIKRL 859.48
1888 FDNRYF 860.38
1889 CYYDG 619.19
1890 EDIFSD 724.29
1891 KCKKRVT 861.52
1892 CRDRKW 862.42
1893 REIRYQ 863.46
1894 FWEKRV 863.46
1895 QKRSFSI 864.48
1896 SHFKSFD 866.39
1897 YLSDHS 720.31
1898 TYQEKVC 869.39
1899 QRIEDLP 869.46
1900 PSELRRI 869.51
1901 EVARLRQ 870.50
1902 QHQFLEA 871.42
1903 RDETLQD 875.40
1904 RAVSPLP 738.44
1905 GLYMDE 726.29
1906 KVGSCK 620.33
1907 ECEWR 721.28
1908 VQELERI 885.49
1909 LQRIEDL 885.49
1910 KDRKRP 798.48
1911 DRKRPSE 886.46
1912 DLVFLLDG 890.47
1913 RCERME 822.35
1914 QDLQKQH 895.45
1915 YKEENNT 896.39
1916 RVKEEVF 905.50
1917 SFSIIG 622.33
1918 VLNAMEC 778.33
1919 FTYVLHE 907.44
1920 QSSWKS 721.34
1921 LLSDRYF 912.47
1922 ELEQQRD 916.42
1923 CSRLLDL 818.43
1924 VLLALALI 824.57
1925 QVLLLPLF 941.59
1926 ILDELLQT 943.52
1927 FTPQNN 719.32
1928 VDFGNSW 823.35
1929 VCGLCGNFDG 983.38
1930 TCGLCGNYNG 1000.37
1931 SCEERNLR 1005.47
1932 GCVSGC 524.17
1933 PIGVGP 538.31
1934 CAGGLE 548.23
1935 GGLECA 548.23
1936 VSPPSC 588.26
1937 IGEDGV 588.27
1938 CSCCSP 598.15
1939 CDATCS 598.17
1940 PLACPV 598.31
1941 WTCPC 608.21
1942 GSGNFQ 608.25
1943 TIAAYA 608.32
1944 DHSACS 618.21
1945 ENGAND 618.22
1946 VCDPVS 618.27
1947 LPSACE 618.27
1948 AGSQVAS 618.30
1949 TMCYC 619.18
1950 TNPGEC 619.23
1951 TVTQGD 619.28
1952 TVKIGC 619.34
1953 ARFAGV 619.34
1954 CPGECL 620.23
1955 EDAVMG 620.25
1956 AEGLEC 620.25
1957 EACLEG 620.25
1958 DVSVDS 620.26
1959 ACEVVT 620.28
1960 SVPYVG 620.32
1961 MHCTM 621.21
1962 DTHFC 621.22
1963 GCRWT 621.27
1964 CVNSTV 621.28
1965 CDPVSC 622.21
1966 MDWDG 622.21
1967 ESIGDC 622.23
1968 CESIGD 622.23
1969 CGLCEV 622.24
1970 LGYLAS 622.33
1971 TATNDC 623.22
1972 GECCGR 623.22
1973 ACQVTC 623.24
1974 PGLHNS 623.30
1975 VKYAGS 623.33
1976 PNAPIL 623.36
1977 PPGKIL 623.40
1978 TCGLCE 624.22
1979 RCPCF 624.25
1980 LCSGFV 624.29
1981 YLASTA 624.31
1982 YAAACAG 625.25
1983 ASKTYG 625.31
1984 RILAGP 625.39
1985 MSMGCV 626.22
1986 AYGFVA 626.31
1987 CSHPSV 628.26
1988 TIGMAH 628.30
1989 APENKA 628.32
1990 PGASKAV 628.35
1991 CNCVNS 638.21
1992 LTCEAC 638.24
1993 TLCECA 638.24
1994 TMVDSS 638.26
1995 TTTTCL 638.29
1996 GMVLYG 638.31
1997 PEEACT 648.24
1998 CPVCEV 648.26
1999 PCPLGY 648.29
2000 ARTCAQ 648.30
2001 GSQVAST 648.31
2002 PFVALC 648.33
2003 SITTID 648.33
2004 LSPVYA 648.35
2005 ATCHNN 658.25
2006 ASQEPQ 658.29
2007 SNVVKL 658.40
2008 LSGRKV 658.41
2009 ETEAGY 668.26
2010 FCDTIA 668.28
2011 APATFY 668.32
2012 CSYLLA 668.32
2013 NIGPRL 668.40
2014 DMEDAV 678.25
2015 SGEMQK 678.30
2016 STIYPV 678.36
2017 FISKAN 678.37
2018 TDHVCD 688.25
2019 RQCVSP 688.33
2020 HSFSIV 688.35
2021 SPLPYL 688.38
2022 ADTRKV 688.39
2023 GKVVTW 688.39
2024 CDTCEE 698.19
2025 VSYLCD 698.29
2026 PASYFD 698.29
2027 QEPGGLV 698.36
2028 ERGLQP 698.37
2029 CEEPEC 708.21
2030 IFAEDD 708.30
2031 PYLDVC 708.31
2032 FDGSMY 718.26
2033 CFHQGK 718.32
2034 VDPEPY 718.32
2035 RNSMVL 718.38
2036 EEPECN 719.24
2037 EGSCVPE 719.28
2038 QDHSFS 719.29
2039 ICRNSQ 719.34
2040 RKVNCT 719.37
2041 FVARID 719.40
2042 DCQDLQ 720.27
2043 DGSSRLS 720.34
2044 VLQRCC 720.34
2045 MVTLGNS 720.35
2046 VRYVQG 720.39
2047 EKTLCE 721.33
2048 SQSSWK 721.34
2049 RVEDFG 721.34
2050 AFVLEGS 721.36
2051 KGLYLE 721.40
2052 IFSKID 721.40
2053 AVRYLT 721.41
2054 LEVILH 722.43
2055 EAPPPTL 723.38
2056 RCHPLV 723.38
2057 YAICQQ 724.32
2058 YLDVCI 724.35
2059 PPLHDF 724.35
2060 LVYMVT 724.38
2061 DVFQDC 725.27
2062 MEYRQ 725.32
2063 TYGLCGI 725.34
2064 LILPGTL 725.47
2065 DHQPCQ 726.27
2066 SDHHTM 726.27
2067 DPYDFA 726.29
2068 LSHRSK 726.41
2069 RPPMVK 726.42
2070 CRSLSY 727.33
2071 GMVRHE 727.34
2072 DEYECA 728.23
2073 YECEW 728.25
2074 GLQPTLT 728.41
2075 WVRVAV 728.43
2076 KRVTIL 728.49
2077 ACCPSCR 738.26
2078 DFANSW 738.30
2079 TLYVED 738.34
2080 MEVTVNG 748.34
2081 VTTDWK 748.38
2082 FQNGKR 748.40
2083 QYVLVQ 748.41
2084 LQYVKV 748.45
2085 YYDGEI 758.31
2086 CPEGQLL 758.36
2087 WTLPDQ 758.36
2088 NSQSPVK 758.39
2089 QRDEIV 758.39
2090 VYHEVL 758.40
2091 EASRIAL 758.43
2092 LTQVSVL 758.45
2093 GKKVTLN 758.46
2094 MCQERC 768.27
2095 AYIGLKD 778.42
2096 HRAVSPL 778.44
2097 QGDQRVS 788.38
2098 QDSIHVT 798.39
2099 KYTLFQ 798.43
2100 IHVTVLQ 808.48
2101 SQGDREQ 818.35
2102 RYFTFS 819.39
2103 WRTPDF 820.39
2104 FQVLLSD 820.43
2105 SNRVTVF 821.44
2106 VESGRYI 822.42
2107 HLGHIFT 823.43
2108 IQLPLLK 823.55
2109 LYMDER 825.37
2110 QTLLKSH 825.47
2111 WRYNSC 827.34
2112 SYMVTVE 827.37
2113 RYFNKT 827.43
2114 RPEASRI 827.46
2115 TRKVPLD 827.49
2116 LQVEEDP 828.39
2117 KGDILQR 828.48
2118 RLSYGED 838.38
2119 FMLRDGT 838.40
2120 QDFETLP 848.39
2121 RYLTSEM 898.42

Step H.

By clicking on Click to Check Enzymatic Digestion the user finds the Unique Peptide Sequences of P07858 derived from enzymatic digestion:

Enzyme Position Peptide Sequence Molecular Mass
Trypsin K or R in C term FAGVLLALALILPGTLCAEGTR 2198.25
CSLFGSDFVNTFDGSMYSFAGYCSYLLAGG
CQK
3537.50
SFSIIGDFQNGK 1311.65
VSLSVYLGEFFDIHLFVNGTVTQGDQR 3040.53
VSMPYASK 881.43
GLYLETEAGYYK 1405.68
LSGEAYGFVAR 1168.59
IDGSGNFQVLLSDR 1519.76
TCGLCGNFNIFAEDDFMTQEGTLTSDPYDF
ANSWALSSGEQWCER
5055.10
ASPPSSSCNISSGEMQK 1708.74
GLWEQCQLLK 1216.63
STSVFAR 766.40
CHPLVDPEPFVALCEK 1795.86
TLCECAGGLECACPALLEYAR 2184.97
TCAQEGMVLYGWTDHSACSPVCPAGMEYR 3161.32
QCVSPCAR 862.38
TCQSLHINEMCQER 1690.72
CVDGCSCPEGQLLDEGLCVESTECPCVHSG
K
3196.29
YPPGTSLSR 976.50
DCNTCICR 926.34
NSQWICSNEECPGECLVTGQSHFK 2695.15
YFTFSGICQYLLAR 1680.83
DCQDHSFSIVIETVQCADDR 2279.98
DAVCTR 663.30
LPGLHNSLVK 1076.63
HGAGVAMDGQDIQLPLLK 1861.97
IQHTVTASVR 1110.61
LSYGEDLQMDWDGR 1683.72
LSPVYAGK 833.46
TCGLCGNYNGNQGDDFLTPSGLAEPR 2698.17
VEDFGNAWK 1064.49
LHGDCQDLQK 1155.53
QHSDPCALNPR 1236.57
FSEEACAVLTSPTFEACHR 2096.93
AVSPLPYLR 1014.59
YDVCSCSDGR 1103.40
ECLCGALASYAAACAGR 1628.71
CELNCPK 805.35
GQVYLQCGTPCNLTCR 1754.79
SLSYPDEECNEACLEGCFCPPGLYMDER 3169.25
GDCVPK 617.28
AQCPCYYDGEIFQPEDIFSDHHTMCYCEDG
FMHCTMSGVPGSLLPDAVLSSPLSHR
6235.64
LVCPADNLR 999.52
AEGLECTK 849.39
TCQNYDLECMSMGCVSGCLCPPGMVR 2796.10
CVALER 689.35
CPCFHQGK 918.38
EYAPGETVK 992.48
IGCNTCVCR 967.40
WNCTDHVCDATCSTIGMAHYLTFDGLK 3001.29
YLFPGECQYVLVQDYCGSNPGTFR 2755.24
GCSHPSVK 813.38
VTILVEGGEIELFDGEVNVK 2159.14
DETHFEVVESGR 1403.63
YIILLLGK 931.61
ALSVVWDR 944.51
HLSISVVLK 994.62
QTYQEK 795.38
VCGLCGNFDGIQNNDLTSSNLQVEEDPVDF
GNSWK
3813.69
VSSQCADTR 965.42
VPLDSSPATCHNNIMK 1725.82
QTMVDSSCR 1025.43
ILTSDVFQDCNK 1381.65
LVDPEPYLDVCIYDTCSCESIGDCACFCDT
IAAYAHVCAQHGK
4640.94
TATLCPQSCEER 1336.57
ENGYECEWR 1184.46
YNSCAPACQVTCQHPEPLACPVQCVEGCHA
HCPPGK
3776.59
ILDELLQTCVDPEDCPVCEVAGR 2516.16
VTLNPSDPEHCQICHCDVVNLTCEACQEPG
GLVVPPTDAPVSPTTLYVEDISEPPLHDFY
CSR
6849.11
LLDLVFLLDGSSR 1446.81
LSEAEFEVLK 1163.61
AFVVDMMER 1096.50
VAVVEYHDGSHAYIGLK 1856.94
IASQVK 644.39
YAGSQVASTSEVLK 1438.73
YTLFQIFSK 1145.61
IALLLMASQEPQR 1468.81
YVQGLK 706.40
VIVIPVGIGPHANLK 1525.93
QAPENK 685.34
AFVLSSVDELEQQR 1619.82
DEIVSYLCDLAPEAPPPTLPPHMAQVTVGP
GLLGVSTLGPK
4179.16
NSMVLDVAFVLEGSDK 1722.85
IGEADFNR 920.43
EFMEEVIQR 1179.56
MDVGQDSIHVTVLQYSYMVTVEYPFSEAQS
K
3550.66
YQGGNR 693.32
TNTGLALR 844.48
YLSDHSFLVSQGDR 1622.77
EQAPNLVYMVTGNPASDEIK 2175.05
LPGDIQVVPIGVGPNANVQELER 2413.30
IGWPNAPILIQDFETLPR 2079.11
EAPDLVLQR 1039.57
CCSGEGLQIPTLSPAPDCSQPLDVILLLDG
SSSFPASYFDEMK
4530.10
ANIGPR 626.35
LTQVSVLQYGSITTIDVPWNVVPEK 2785.49
AHLLSLVDVMQR 1380.75
EGGPSQIGDALGFAVR 1572.79
YLTSEMHGAR 1163.54
AVVILVTDVSVDSVDAAADAAR 2156.13
VTVFPIGIGDR 1172.65
YDAAQLR 835.42
ILAGPAGDSNVVK 1239.68
IEDLPTMVTLGNSFLHK 1913.99
LCSGFVR 780.39
ICMDEDGNEK 1152.44
PGDVWTLPDQCHTVTCQPDGQTLLK 2751.30
PSCPNSQSPVK 1142.54
VEETCGCR 895.35
WTCPCVCTGSSTR 1399.57
HIVTFDGQNFK 1304.65
LTGSCSYVLFQNK 1458.72
EQDLEVILHNGACSPGAR 1907.92
QGCMK 565.23
HSALSVELHSDMEVTVNGR 2080.00
LVSVPYVGGNMEVNVYGAIMHEVR 2632.31
FNHLGHIFTFTPQNNEFQLQLSPK 2856.43
TYGLCGICDENGANDFMLR 2090.89
DGTVTTDWK 1021.47
TLVQEWTVQR 1258.67
PGQTCQPILEEQCLVPDSSHCQVLLLPLFA
ECHK
3774.82
VLAPATFYAICQQDSCHQEQVCEVIASYAH
LCR
3695.70
TNGVCVDWR 1048.48
TPDFCAMSCPPSLVYNHCEHGCPR 2663.08
HCDGNVSSCGDHPSEGCFCPPDK 2389.88
VMLEGSCVPEEACTQCIGEDGVQHQFLEAW
VPDHQPCQICTCLSGR
5045.20
VNCTTQPCPTAK 1261.58
APTCGLCEVAR 1118.52
QNADQCCPEYECVCDPVSCDLPPVPHCER 3248.28
GLQPTLTNPGECR 1384.68
PNFTCACR 910.38
VSPPSCPPHR 1075.52
TQCCDEYECACNCVNSTVSCPLGYLASTAT
NDCGCTTTTCLPDK
4600.79
VCVHR 612.32
STIYPVGQFWEEGCDVCTCTDMEDAVMGLR
3354.40
VAQCSQK 762.37
PCEDSCR 808.28
SGFTYVLHEGECCGR 1656.70
CLPSACEVVTGSPR 1417.67
GDSQSSWK 893.39
SVGSQWASPENPCLINECVR 2188.00
EEVFIQQR 1047.53
NVSCPQLEVPVCPSGFQLSCK 2234.05
TSACCPSCR 926.34
MEACMLNGTVIGPGK 1519.72
TVMIDVCTTCR 1240.56
CMVQVGVISGFK 1266.65
TTCNPCPLGYK 1195.54
EENNTGECCGR 1210.43
CLPTACTIQLR 1217.63
GGQIMTLK 846.46
DETLQDGCDTHFCK 1610.63
GEYFWEK 957.42
VTGCPPFDEHK 1228.55
CLAEGGK 676.32
IPGTCCDTCEEPECNDITAR 2168.85
SEVEVDIHYCQGK 1505.68
AMYSIDINDVQDQCSCCSPTR 2347.95
TEPMQVALHCTNGSVVYHEVLNAMECK 3002.38
Arg-C R in C term FAGVLLALALILPGTLCAEGTR 2198.25
CSLFGSDFVNTFDGSMYSFAGYCSYLLAGG
CQKR
3693.60
SFSIIGDFQNGKR 1467.75
VSLSVYLGEFFDIHLFVNGTVTQGDQR 3040.53
VSMPYASKGLYLETEAGYYKLSGEAYGFVA
R
3419.67
IDGSGNFQVLLSDR 1519.76
YFNKTCGLCGNFNIFAEDDFMTQEGTLTSD
PYDFANSWALSSGEQWCER
5607.37
ASPPSSSCNISSGEMQKGLWEQCQLLKSTS
VFAR
3655.74
CHPLVDPEPFVALCEKTLCECAGGLECACP
ALLEYAR
3962.82
TCAQEGMVLYGWTDHSACSPVCPAGMEYR 3161.32
QCVSPCAR 862.38
TCQSLHINEMCQER 1690.72
CVDGCSCPEGQLLDEGLCVESTECPCVHSG
KR
3352.40
YPPGTSLSR 976.50
DCNTCICR 926.34
NSQWICSNEECPGECLVTGQSHFKSFDNR 3314.42
YFTFSGICQYLLAR 1680.83
DCQDHSFSIVIETVQCADDR 2279.98
DAVCTR 663.30
LPGLHNSLVKLKHGAGVAMDGQDIQLPLLK
GDLR
3603.01
IQHTVTASVR 1110.61
LSYGEDLQMDWDGR 1683.72
LLVKLSPVYAGKTCGLCGNYNGNQGDDFLT
PSGLAEPR
3966.96
VEDFGNAWKLHGDCQDLQKQHSDPCALNPR
3420.57
FSEEACAVLTSPTFEACHR 2096.93
AVSPLPYLR 1014.59
YDVCSCSDGR 1103.40
ECLCGALASYAAACAGR 1628.71
CELNCPKGQVYLQCGTPCNLTCR 2542.13
SLSYPDEECNEACLEGCFCPPGLYMDER 3169.25
GDCVPKAQCPCYYDGEIFQPEDIFSDHHTM
CYCEDGFMHCTMSGVPGSLLPDAVLSSPLS
HR
6834.92
PPMVKLVCPADNLR 1551.83
AEGLECTKTCQNYDLECMSMGCVSGCLCPP
GMVR
3627.48
CVALER 689.35
CPCFHQGKEYAPGETVKIGCNTCVCR 2842.25
KWNCTDHVCDATCSTIGMAHYLTFDGLKYL
FPGECQYVLVQDYCGSNPGTFR
5866.61
ILVGNKGCSHPSVKCKKR 1953.08
VTILVEGGEIELFDGEVNVKR 2315.24
PMKDETHFEVVESGR 1759.82
YIILLLGKALSVVWDR 1858.11
HLSISVVLKQTYQEKVCGLCGNFDGIQNND
LTSSNLQVEEDPVDFGNSWKVSSQCADTR
6515.07
KVPLDSSPATCHNNIMKQTMVDSSCR 2861.33
ILTSDVFQDCNKLVDPEPYLDVCIYDTCSC
ESIGDCACFCDTIAAYAHVCAQHGKVVTWR
6645.95
TATLCPQSCEER 1336.57
ENGYECEWR 1184.46
YNSCAPACQVTCQHPEPLACPVQCVEGCHA
HCPPGKILDELLQTCVDPEDCPVCEVAGR
6274.74
FASGKKVTLNPSDPEHCQICHCDVVNLTCE
ACQEPGGLVVPPTDAPVSPTTLYVEDISEP
PLHDFYCSR
7467.46
LLDLVFLLDGSSR 1446.81
LSEAEFEVLKAFVVDMMER 2242.10
ISQKWVR 915.53
VAVVEYHDGSHAYIGLKDR 2128.07
IASQVKYAGSQVASTSEVLKYTLFQIFSKI
DR
3576.92
IALLLMASQEPQR 1468.81
YVQGLKKKKVIVIPVGIGPHANLKQIR 2995.85
LIEKQAPENKAFVLSSVDELEQQR 2770.45
DEIVSYLCDLAPEAPPPTLPPHMAQVTVGP
GLLGVSTLGPKR
4335.26
NSMVLDVAFVLEGSDKIGEADFNR 2625.27
SKEFMEEVIQR 1394.69
MDVGQDSIHVTVLQYSYMVTVEYPFSEAQS
KGDILQR
4233.04
YQGGNR 693.32
TNTGLALR 844.48
YLSDHSFLVSQGDR 1622.77
EQAPNLVYMVTGNPASDEIKR 2331.15
LPGDIQVVPIGVGPNANVQELER 2413.30
IGWPNAPILIQDFETLPR 2079.11
EAPDLVLQR 1039.57
CCSGEGLQIPTLSPAPDCSQPLDVILLLDG
SSSFPASYFDEMKSFAKAFISKANIGPR
6117.99
LTQVSVLQYGSITTIDVPWNVVPEKAHLLS
LVDVMQR
4148.23
EGGPSQIGDALGFAVR 1572.79
YLTSEMHGAR 1163.54
PGASKAVVILVTDVSVDSVDAAADAAR 2596.37
VTVFPIGIGDR 1172.65
YDAAQLR 835.42
ILAGPAGDSNVVKLQR 1636.93
IEDLPTMVTLGNSFLHKLCSGFVR 2676.38
ICMDEDGNEKR 1308.54
PGDVWTLPDQCHTVTCQPDGQTLLKSHR 3131.49
PSCPNSQSPVKVEETCGCR 2019.88
WTCPCVCTGSSTR 1399.57
HIVTFDGQNFKLTGSCSYVLFQNKEQDLEV
ILHNGACSPGAR
4635.26
QGCMKSIEVKHSALSVELHSDMEVTVNGR 3183.55
LVSVPYVGGNMEVNVYGAIMHEVR 2632.31
FNHLGHIFTFTPQNNEFQLQLSPKTFASKT
YGLCGICDENGANDFMLR
5463.59
DGTVTTDWKTLVQEWTVQR 2262.13
PGQTCQPILEEQCLVPDSSHCQVLLLPLFA
ECHKVLAPATFYAICQQDSCHQEQVCEVIA
SYAHLCR
7452.51
TNGVCVDWR 1048.48
TPDFCAMSCPPSLVYNHCEHGCPR 2663.08
HCDGNVSSCGDHPSEGCFCPPDKVMLEGSC
VPEEACTQCIGEDGVQHQFLEAWVPDHQPC
QICTCLSGR
7417.08
KVNCTTQPCPTAKAPTCGLCEVAR 2490.18
QNADQCCPEYECVCDPVSCDLPPVPHCER 3248.28
GLQPTLTNPGECR 1384.68
PNFTCACR 910.38
VSPPSCPPHR 1075.52
KTQCCDEYECACNCVNSTVSCPLGYLASTA
TNDCGCTTTTCLPDKVCVHR
5323.20
STIYPVGQFWEEGCDVCTCTDMEDAVMGLR
3354.40
VAQCSQKPCEDSCR 1552.64
SGFTYVLHEGECCGR 1656.70
CLPSACEVVTGSPR 1417.67
GDSQSSWKSVGSQWASPENPCLINECVR 3063.38
VKEEVFIQQR 1274.70
NVSCPQLEVPVCPSGFQLSCKTSACCPSCR
3142.38
MEACMLNGTVIGPGKTVMIDVCTTCR 2742.27
CMVQVGVISGFKLECR 1767.88
KTTCNPCPLGYKEENNTGECCGR 2516.05
CLPTACTIQLR 1217.63
GGQIMTLKR 1002.56
DETLQDGCDTHFCKVNER 2108.89
GEYFWEKR 1113.52
VTGCPPFDEHKCLAEGGKIMKIPGTCCDTC
EEPECNDITAR
4409.92
LQYVKVGSCKSEVEVDIHYCQGKCASKAMY
SIDINDVQDQCSCCSPTR
5330.39
TEPMQVALHCTNGSVVYHEVLNAMECKCSP
R
3445.57
Chymotrypsin F or Y or W or L in C term MIPARF 733.39
CAEGTRGRSSTARCSL 1653.77
AGGCQKRSF 952.45
SIIGDF 650.33
QNGKRVSL 900.51
VNGTVTQGDQRVSMPY 1750.83
ETEAGY 668.26
VARIDGSGNF 1034.51
MTQEGTL 778.35
SSGEQW 692.28
CERASPPSSSCNISSGEMQKGL 2267.00
ARCHPL 695.35
VDPEPF 702.32
CECAGGL 651.24
ECACPAL 705.28
ARTCAQEGMVL 1177.56
TDHSACSPVCPAGMEY 1666.64
RQCVSPCARTCQSL 1550.71
HINEMCQERCVDGCSCPEGQL 2349.93
CVESTECPCVHSGKRY 1796.76
SRDCNTCICRNSQW 1684.69
ICSNEECPGECL 1295.48
VTGQSHF 774.37
SGICQY 669.28
ARDCQDHSF 1077.43
SIVIETVQCADDRDAVCTRSVTVRL 2748.39
KHGAGVAMDGQDIQL 1538.75
RIQHTVTASVRL 1379.80
AGKTCGL 648.33
NGNQGDDF 865.32
AEPRVEDF 961.45
HGDCQDL 786.30
QKQHSDPCAL 1125.52
NPRMTRF 920.46
SEEACAVL 820.36
EACHRAVSPL 1081.53
RNCRY 710.33
DVCSCSDGRECL 1285.47
AAACAGRGVRVAW 1286.67
REPGRCEL 958.46
NCPKGQVY 907.42
QCGTPCNL 834.34
PDEECNEACL 1121.40
MDERGDCVPKAQCPCY 1813.73
QPEDIF 747.34
SDHHTMCY 992.35
MHCTMSGVPGSL 1218.52
SHRSKRSL 969.55
SCRPPMVKL 1029.55
VCPADNL 730.33
ECTKTCQNY 1088.43
ECMSMGCVSGCL 1218.42
CPPGMVRHENRCVAL 1680.80
ERCPCF 753.29
HQGKEY 760.35
APGETVKIGCNTCVCRDRKW 2235.07
NCTDHVCDATCSTIGMAHY 2040.78
PGECQY 695.26
CGSNPGTF 781.31
VGNKGCSHPSVKCKKRVTIL 2153.19
VEGGEIEL 844.42
DGEVNVKRPMKDETHF 1900.91
EVVESGRY 937.45
QEKVCGL 775.39
DGIQNNDL 887.40
QVEEDPVDF 1076.47
KVSSQCADTRKVPL 1530.82
DSSPATCHNNIMKQTMVDSSCRIL 2650.20
QDCNKL 719.33
VDPEPY 718.32
DVCIY 611.26
DTCSCESIGDCACF 1452.47
CDTIAAY 755.32
AHVCAQHGKVVTW 1434.72
CPQSCEERNL 1177.49
NSCAPACQVTCQHPEPL 1796.76
ACPVQCVEGCHAHCPPGKIL 2060.94
QTCVDPEDCPVCEVAGRRF 2122.92
ASGKKVTL 802.49
NPSDPEHCQICHCDVVNL 2021.84
TCEACQEPGGL 1106.44
VVPPTDAPVSPTTL 1392.75
VEDISEPPL 997.50
VVDMMERL 991.48
RISQKW 816.46
VRVAVVEY 933.53
HDGSHAY 785.31
KDRKRPSEL 1127.64
RRIASQVKY 1119.65
AGSQVASTSEVL 1147.57
SKIDRPEASRIAL 1454.82
MASQEPQRMSRNF 1580.72
KKKKVIVIPVGIGPHANL 1910.22
IEKQAPENKAF 1273.67
EQQRDEIVSY 1265.59
APEAPPPTL 891.47
PPHMAQVTVGPGL 1302.67
GPKRNSMVL 1000.55
EGSDKIGEADF 1166.51
MEEVIQRMDVGQDSIHVTVL 2298.13
MVTVEY 740.34
SEAQSKGDIL 1046.52
QRVREIRY 1118.63
QGGNRTNTGL 1016.50
VSQGDREQAPNL 1312.64
MVTGNPASDEIKRL 1529.79
PGDIQVVPIGVGPNANVQEL 2015.07
PNAPIL 623.36
PREAPDL 796.41
QRCCSGEGL 951.39
SPAPDCSQPL 1013.45
DEMKSF 755.32
ISKANIGPRL 1067.64
GSITTIDVPW 1087.55
NVVPEKAHL 1005.56
VDVMQREGGPSQIGDAL 1770.86
TSEMHGARPGASKAVVIL 1822.97
VTDVSVDSVDAAADAARSNRVTVF 2464.22
PIGIGDRY 889.47
AGPAGDSNVVKL 1126.60
PTMVTL 660.35
VRICMDEDGNEKRPGDVW 2117.96
PDQCHTVTCQPDGQTL 1741.74
KSHRVNCDRGL 1283.65
RPSCPNSQSPVKVEETCGCRW 2362.06
TCPCVCTGSSTRHIVTF 1810.82
DGQNF 579.23
TGSCSY 616.22
QNKEQDL 873.42
HNGACSPGARQGCMKSIEVKHSAL 2480.18
HSDMEVTVNGRL 1356.65
VGGNMEVNVY 1080.49
GAIMHEVRF 1058.53
TPQNNEF 848.37
CGICDENGANDF 1256.44
RDGTVTTDW 1049.48
TVQRPGQTCQPIL 1439.75
VPDSSHCQVL 1083.50
AECHKVL 798.41
AICQQDSCHQEQVCEVIASY 2252.95
CRTNGVCVDW 1151.48
CAMSCPPSL 907.36
NHCEHGCPRHCDGNVSSCGDHPSEGCF 2883.04
CPPDKVML 901.44
EGSCVPEEACTQCIGEDGVQHQF 2464.99
VPDHQPCQICTCL 1455.63
SGRKVNCTTQPCPTAKAPTCGL 2232.08
CEVARL 689.35
RQNADQCCPEY 1325.51
ECVCDPVSCDL 1181.44
PPVPHCERGL 1103.55
TNPGECRPNF 1133.49
TCACRKEECKRVSPPSCPPHRL 2496.20
RKTQCCDEY 1144.46
ECACNCVNSTVSCPL 1541.60
ASTATNDCGCTTTTCL 1561.61
PDKVCVHRSTIY 1416.72
EEGCDVCTCTDMEDAVMGL 2019.72
RVAQCSQKPCEDSCRSGF 1999.87
HEGECCGRCL 1105.41
PSACEVVTGSPRGDSQSSW 1948.86
KSVGSQW 790.40
ASPENPCL 829.36
INECVRVKEEVF 1463.74
IQQRNVSCPQL 1284.66
EVPVCPSGF 933.43
SCKTSACCPSCRCERMEACML 2310.88
NGTVIGPGKTVMIDVCTTCRCMVQVGVISG
F
3184.56
ECRKTTCNPCPL 1363.60
KEENNTGECCGRCL 1554.62
PTACTIQL 845.43
RGGQIMTL 874.47
KRDETL 760.41
QDGCDTHF 921.33
CKVNERGEY 1096.50
EKRVTGCPPF 1132.57
DEHKCL 743.33
AEGGKIMKIPGTCCDTCEEPECNDITARL 3096.37
VKVGSCKSEVEVDIHY 1790.89
CQGKCASKAMY 1188.51
SIDINDVQDQCSCCSPTRTEPMQVAL 2852.24
HCTNGSVVY 978.42
NAMECKCSPRKCSK 1583.70
Formic Acid D in C term MIPARFAGVLLALALILPGTLCAEGTRGRS
STARCSLFGSD
4191.21
FVNTFD 741.33
GSMYSFAGYCSYLLAGGCQKRSFSIIGD 2980.36
FQNGKRVSLSVYLGEFFD 2105.06
IHLFVNGTVTQGD 1399.71
QRVSMPYASKGLYLETEAGYYKLSGEAYGF
VARID
3931.95
GSGNFQVLLSD 1135.55
RYFNKTCGLCGNFNIFAED 2210.99
FMTQEGTLTSD 1228.53
FANSWALSSGEQWCERASPPSSSCNISSGE
MQKGLWEQCQLLKSTSVFARCHPLVD
6171.84
PEPFVALCEKTLCECAGGLECACPALLEYA
RTCAQEGMVLYGWTD
4853.17
HSACSPVCPAGMEYRQCVSPCARTCQSLHI
NEMCQERCVD
4440.85
GCSCPEGQLLD 1120.45
EGLCVESTECPCVHSGKRYPPGTSLSRD 3006.36
CNTCICRNSQWICSNEECPGECLVTGQSHF
KSFD
3837.58
NRYFTFSGICQYLLARD 2066.00
HSFSIVIETVQCAD 1547.73
AVCTRSVTVRLPGLHNSLVKLKHGAGVAMD
3128.71
IQLPLLKGD 995.60
LRIQHTVTASVRLSYGED 2044.07
GRGRLLVKLSPVYAGKTCGLCGNYNGNQGD
3109.55
FLTPSGLAEPRVED 1529.77
FGNAWKLHGD 1143.55
LQKQHSD 854.42
PCALNPRMTRFSEEACAVLTSPTFEACHRA
VSPLPYLRNCRYD
4884.32
VCSCSD 612.19
GRECLCGALASYAAACAGRGVRVAWREPGR
CELNCPKGQVYLQCGTPCNLTCRSLSYPD
6291.93
EECNEACLEGCFCPPGLYMD 2221.81
CVPKAQCPCYYD 1388.56
GEIFQPED 933.41
HHTMCYCED 1137.37
GFMHCTMSGVPGSLLPD 1747.77
AVLSSPLSHRSKRSLSCRPPMVKLVCPAD 3133.67
NLRAEGLECTKTCQNYD 1956.87
LECMSMGCVSGCLCPPGMVRHENRCVALER
CPCFHQGKEYAPGETVKIGCNTCVCRD
6218.70
RKWNCTD 921.41
ATCSTIGMAHYLTFD 1629.72
GLKYLFPGECQYVLVQD 1970.98
YCGSNPGTFRILVGNKGCSHPSVKCKKRVT
ILVEGGEIELFD
4550.32
GEVNVKRPMKD 1271.67
ETHFEVVESGRYIILLLGKALSVVWD 2972.60
RHLSISVVLKQTYQEKVCGLCGNFD 2836.44
GIQNND 659.29
LTSSNLQVEED 1233.57
FGNSWKVSSQCAD 1427.61
TRKVPLD 827.49
SSPATCHNNIMKQTMVD 1875.83
SSCRILTSD 980.46
PEPYLD 732.33
VCIYD 611.26
TCSCESIGD 913.32
CACFCD 660.17
TIAAYAHVCAQHGKVVTWRTATLCPQSCEE
RNLRENGYECEWRYNSCAPACQVTCQHPEP
LACPVQCVEGCHAHCPPGKILD
9078.10
ELLQTCVD 919.43
CPVCEVAGRRFASGKKVTLNPSD 2433.23
PEHCQICHCD 1183.42
VVNLTCEACQEPGGLVVPPTD 2140.02
APVSPTTLYVED 1290.63
ISEPPLHD 906.44
FYCSRLLD 1015.48
GSSRLSEAEFEVLKAFVVD 2082.06
MMERLRISQKWVRVAVVEYHD 2644.37
GSHAYIGLKD 1059.53
RKRPSELRRIASQVKYAGSQVASTSEVLKY
TLFQIFSKID
4599.53
RPEASRIALLLMASQEPQRMSRNFVRYVQG
LKKKKVIVIPVGIGPHANLKQIRLIEKQAP
ENKAFVLSSVD
8002.52
ELEQQRD 916.42
EIVSYLCD 940.42
LAPEAPPPTLPPHMAQVTVGPGLLGVSTLG
PKRNSMVLD
3957.12
VAFVLEGSD 935.46
KIGEAD 631.32
FNRSKEFMEEVIQRMD 2057.97
SIHVTVLQYSYMVTVEYPFSEAQSKGD 3077.47
ILQRVREIRYQGGNRTNTGLALRYLSD 3161.72
HSFLVSQGD 988.46
REQAPNLVYMVTGNPASD 1960.93
EIKRLPGD 926.52
IQVVPIGVGPNANVQELERIGWPNAPILIQ
D
3348.82
FETLPREAPD 1173.57
LVLQRCCSGEGLQIPTLSPAPD 2296.16
CSQPLD 661.27
GSSSFPASYFD 1163.48
EMKSFAKAFISKANIGPRLTQVSVLQYGSI
TTID
3712.99
VPWNVVPEKAHLLSLVD 1915.06
VMQREGGPSQIGD 1372.64
ALGFAVRYLTSEMHGARPGASKAVVILVTD
3128.68
AARSNRVTVFPIGIGD 1671.91
AAQLRILAGPAGD 1251.69
SNVVKLQRIED 1299.71
LPTMVTLGNSFLHKLCSGFVRICMD 2781.38
GNEKRPGD 871.41
VWTLPD 729.37
QCHTVTCQPD 1130.45
GQTLLKSHRVNCD 1469.74
RGLRPSCPNSQSPVKVEETCGCRWTCPCVC
TGSSTRHIVTFD
4596.10
GQNFKLTGSCSYVLFQNKEQD 2405.13
LEVILHNGACSPGARQGCMKSIEVKHSALS
VELHSD
3814.89
MEVTVNGRLVSVPYVGGNMEVNVYGAIMHE
VRFNHLGHIFTFTPQNNEFQLQLSPKTFAS
KTYGLCGICD
7816.82
ENGAND 618.22
GTVTTD 592.27
WKTLVQEWTVQRPGQTCQPILEEQCLVPD 3423.70
SSHCQVLLLPLFAECHKVLAPATFYAICQQ
D
3444.70
SCHQEQVCEVIASYAHLCRTNGVCVD 2863.25
FCAMSCPPSLVYNHCEHGCPRHCD 2705.05
GNVSSCGD 737.26
HPSEGCFCPPD 1187.44
KVMLEGSCVPEEACTQCIGED 2239.95
GVQHQFLEAWVPD 1524.74
HQPCQICTCLSGRKVNCTTQPCPTAKAPTC
GLCEVARLRQNAD
4614.16
QCCPEYECVCD 1290.40
LPPVPHCERGLQPTLTNPGECRPNFTCACR
KEECKRVSPPSCPPHRLPTLRKTQCCD
6395.08
EYECACNCVNSTVSCPLGYLASTATND 2827.14
CGCTTTTCLPD 1113.41
KVCVHRSTIYPVGQFWEEGCD 2452.13
VCTCTD 640.22
AVMGLRVAQCSQKPCED 1833.85
SCRSGFTYVLHEGECCGRCLPSACEVVTGS
PRGD
3574.55
SQSSWKSVGSQWASPENPCLINECVRVKEE
VFIQQRNVSCPQLEVPVCPSGFQLSCKTSA
CCPSCRCERMEACMLNGTVIGPGKTVMID
9721.52
VCTTCRCMVQVGVISGFKLECRKTTCNPCP
LGYKEENNTGECCGRCLPTACTIQLRGGQI
MTLKRD
7228.41
THFCKVNERGEYFWEKRVTGCPPFD 3044.41
EHKCLAEGGKIMKIPGTCCD 2131.99
TCEEPECND 1038.33
ITARLQYVKVGSCKSEVEVD 2223.16
IHYCQGKCASKAMYSID 1916.86
QCSCCSPTRTEPMQVALHCTNGSVVYHEVL
NAMECKCSPRKCSK
4857.15
Lys-C K in C term MIPARFAGVLLALALILPGTLCAEGTRGRS
STARCSLFGSDFVNTFDGSMYSFAGYCSYL
LAGGCQK
7001.43
RSFSIIGDFQNGK 1467.75
RVSLSVYLGEFFDIHLFVNGTVTQGDQRVS
MPYASK
4060.05
GLYLETEAGYYK 1405.68
LSGEAYGFVARIDGSGNFQVLLSDRYFNK 3222.61
TCGLCGNFNIFAEDDFMTQEGTLTSDPYDF
ANSWALSSGEQWCERASPPSSSCNISSGEM
QK
6745.83
GLWEQCQLLK 1216.63
STSVFARCHPLVDPEPFVALCEK 2544.25
TLCECAGGLECACPALLEYARTCAQEGMVL
YGWTDHSACSPVCPAGMEYRQCVSPCARTC
QSLHINEMCQERCVDGCSCPEGQLLDEGLC
VESTECPCVHSGK
11023.64
RYPPGTSLSRDCNTCICRNSQWICSNEECP
GECLVTGQSHFK
4718.06
SFDNRYFTFSGICQYLLARDCQDHSFSIVI
ETVQCADDRDAVCTRSVTVRLPGLHNSLVK
6808.30
HGAGVAMDGQDIQLPLLK 1861.97
GDLRIQHTVTASVRLSYGEDLQMDWDGRGR
LLVK
3884.01
LSPVYAGK 833.46
TCGLCGNYNGNQGDDFLTPSGLAEPRVEDF
GNAWK
3744.66
LHGDCQDLQK 1155.53
QHSDPCALNPRMTRFSEEACAVLTSPTFEA
CHRAVSPLPYLRNCRYDVCSCSDGRECLCG
ALASYAAACAGRGVRVAWREPGRCELNCPK
9820.53
GQVYLQCGTPCNLTCRSLSYPDEECNEACL
EGCFCPPGLYMDERGDCVPK
5505.30
AQCPCYYDGEIFQPEDIFSDHHTMCYCEDG
FMHCTMSGVPGSLLPDAVLSSPLSHRSK
6450.77
RSLSCRPPMVK 1272.68
LVCPADNLRAEGLECTK 1830.90
TCQNYDLECMSMGCVSGCLCPPGMVRHENR
CVALERCPCFHQGK
4904.06
EYAPGETVK 992.48
IGCNTCVCRDRK 1366.63
WNCTDHVCDATCSTIGMAHYLTFDGLK 3001.29
YLFPGECQYVLVQDYCGSNPGTFRILVGNK
3379.64
GCSHPSVK 813.38
RVTILVEGGEIELFDGEVNVK 2315.24
DETHFEVVESGRYIILLLGK 2317.23
ALSVVWDRHLSISVVLK 1921.11
QTYQEK 795.38
VCGLCGNFDGIQNNDLTSSNLQVEEDPVDF
GNSWK
3813.69
VSSQCADTRK 1093.52
VPLDSSPATCHNNIMK 1725.82
QTMVDSSCRILTSDVFQDCNK 2389.07
LVDPEPYLDVCIYDTCSCESIGDCACFCDT
IAAYAHVCAQHGK
4640.94
VVTWRTATLCPQSCEERNLRENGYECEWRY
NSCAPACQVTCQHPEPLACPVQCVEGCHAH
CPPGK
7286.19
ILDELLQTCVDPEDCPVCEVAGRRFASGK 3162.51
VTLNPSDPEHCQICHCDVVNLTCEACQEPG
GLVVPPTDAPVSPTTLYVEDISEPPLHDFY
CSRLLDLVFLLDGSSRLSEAEFEVLK
9423.51
AFVVDMMERLRISQK 1821.96
WVRVAVVEYHDGSHAYIGLK 2298.19
RPSELRRIASQVK 1538.90
YAGSQVASTSEVLK 1438.73
YTLFQIFSK 1145.61
IDRPEASRIALLLMASQEPQRMSRNFVRYV
QGLK
3972.13
VIVIPVGIGPHANLK 1525.93
QIRLIEK 898.56
QAPENK 685.34
AFVLSSVDELEQQRDEIVSYLCDLAPEAPP
PTLPPHMAQVTVGPGLLGVSTLGPK
5780.97
RNSMVLDVAFVLEGSDK 1878.95
IGEADFNRSK 1135.56
EFMEEVIQRMDVGQDSIHVTVLQYSYMVTV
EYPFSEAQSK
4712.21
GDILQRVREIRYQGGNRTNTGLALRYLSDH
SFLVSQGDREQAPNLVYMVTGNPASDEIK
6617.36
RLPGDIQVVPIGVGPNANVQELERIGWPNA
PILIQDFETLPREAPDLVLQRCCSGEGLQI
PTLSPAPDCSQPLDVILLLDGSSSFPASYF
DEMK
10164.15
ANIGPRLTQVSVLQYGSITTIDVPWNVVPE
K
3393.83
AHLLSLVDVMQREGGPSQIGDALGFAVRYL
TSEMHGARPGASK
4521.30
AVVILVTDVSVDSVDAAADAARSNRVTVFP
IGIGDRYDAAQLRILAGPAGDSNVVK
5707.03
LQRIEDLPTMVTLGNSFLHK 2311.24
LCSGFVRICMDEDGNEK 1914.83
RPGDVWTLPDQCHTVTCQPDGQTLLK 2907.40
SHRVNCDRGLRPSCPNSQSPVK 2436.19
VEETCGCRWTCPCVCTGSSTRHIVTFDGQN
FK
3563.55
LTGSCSYVLFQNK 1458.72
EQDLEVILHNGACSPGARQGCMK 2455.14
HSALSVELHSDMEVTVNGRLVSVPYVGGNM
EVNVYGAIMHEVRFNHLGHIFTFTPQNNEF
QLQLSPK
7532.73
TYGLCGICDENGANDFMLRDGTVTTDWK 3094.35
TLVQEWTVQRPGQTCQPILEEQCLVPDSSH
CQVLLLPLFAECHK
5015.48
VLAPATFYAICQQDSCHQEQVCEVIASYAH
LCRTNGVCVDWRTPDFCAMSCPPSLVYNHC
EHGCPRHCDGNVSSCGDHPSEGCFCPPDK
9743.11
VMLEGSCVPEEACTQCIGEDGVQHQFLEAW
VPDHQPCQICTCLSGRK
5173.30
VNCTTQPCPTAK 1261.58
APTCGLCEVARLRQNADQCCPEYECVCDPV
SCDLPPVPHCERGLQPTLTNPGECRPNFTC
ACRK
7005.11
RVSPPSCPPHRLPTLRK 1940.09
TQCCDEYECACNCVNSTVSCPLGYLASTAT
NDCGCTTTTCLPDK
4600.79
VCVHRSTIYPVGQFWEEGCDVCTCTDMEDA
VMGLRVAQCSQK
4693.07
PCEDSCRSGFTYVLHEGECCGRCLPSACEV
VTGSPRGDSQSSWK
4722.01
SVGSQWASPENPCLINECVRVK 2415.17
EEVFIQQRNVSCPQLEVPVCPSGFQLSCK 3263.58
TSACCPSCRCERMEACMLNGTVIGPGK 2816.20
TVMIDVCTTCRCMVQVGVISGFK 2489.20
TTCNPCPLGYK 1195.54
EENNTGECCGRCLPTACTIQLRGGQIMTLK
3238.50
RDETLQDGCDTHFCK 1766.73
VNERGEYFWEK 1455.68
RVTGCPPFDEHK 1384.66
CLAEGGK 676.32
IPGTCCDTCEEPECNDITARLQYVK 2800.22
SEVEVDIHYCQGK 1505.68
AMYSIDINDVQDQCSCCSPTRTEPMQVALH
CTNGSVVYHEVLNAMECK
5332.32
PepsinA F or L in C term MIPARF 733.39
CAEGTRGRSSTARCSL 1653.77
DGSMYSF 805.29
AGYCSYL 775.32
AGGCQKRSF 952.45
SIIGDF 650.33
QNGKRVSL 900.51
VNGTVTQGDQRVSMPYASKGL 2207.10
ETEAGYYKL 1072.51
SGEAYGF 729.30
VARIDGSGNF 1034.51
MTQEGTL 778.35
TSDPYDF 843.33
ANSWAL 660.32
SSGEQWCERASPPSSSCNISSGEMQKGL 2941.26
WEQCQL 805.34
ARCHPL 695.35
VDPEPF 702.32
CECAGGL 651.24
ECACPAL 705.28
EYARTCAQEGMVL 1469.66
YGWTDHSACSPVCPAGMEYRQCVSPCARTC
QSL
3605.51
HINEMCQERCVDGCSCPEGQL 2349.93
CVESTECPCVHSGKRYPPGTSL 2349.05
SRDCNTCICRNSQWICSNEECPGECL 2962.16
VTGQSHF 774.37
SGICQYL 782.36
ARDCQDHSF 1077.43
SIVIETVQCADDRDAVCTRSVTVRL 2748.39
KHGAGVAMDGQDIQL 1538.75
RIQHTVTASVRL 1379.80
QMDWDGRGRL 1232.57
SPVYAGKTCGL 1094.54
CGNYNGNQGDDF 1302.46
AEPRVEDF 961.45
GNAWKL 687.37
HGDCQDL 786.30
QKQHSDPCAL 1125.52
NPRMTRF 920.46
SEEACAVL 820.36
EACHRAVSPL 1081.53
RNCRYDVCSCSDGRECL 1977.79
ASYAAACAGRGVRVAWREPGRCEL 2548.25
NCPKGQVYL 1020.51
QCGTPCNL 834.34
SYPDEECNEACL 1371.50
YMDERGDCVPKAQCPCYYDGEIF 2701.10
QPEDIF 747.34
SDHHTMCYCEDGF 1543.52
MHCTMSGVPGSL 1218.52
SHRSKRSL 969.55
SCRPPMVKL 1029.55
VCPADNL 730.33
ECTKTCQNYDL 1316.54
ECMSMGCVSGCL 1218.42
CPPGMVRHENRCVAL 1680.80
ERCPCF 753.29
HQGKEYAPGETVKIGCNTCVCRDRKWNCTD
HVCDATCSTIGMAHYL
5113.26
PGECQYVL 907.41
VQDYCGSNPGTF 1286.52
VGNKGCSHPSVKCKKRVTIL 2153.19
VEGGEIEL 844.42
DGEVNVKRPMKDETHF 1900.91
EVVESGRYIIL 1276.70
SVVWDRHL 1010.53
KQTYQEKVCGL 1295.65
DGIQNNDL 887.40
QVEEDPVDF 1076.47
GNSWKVSSQCADTRKVPL 1974.99
DSSPATCHNNIMKQTMVDSSCRIL 2650.20
QDCNKL 719.33
VDPEPYL 831.40
DVCIYDTCSCESIGDCACF 2045.72
CDTIAAYAHVCAQHGKVVTWRTATL 2714.34
CPQSCEERNL 1177.49
RENGYECEWRYNSCAPACQVTCQHPEPL 3282.37
ACPVQCVEGCHAHCPPGKIL 2060.94
QTCVDPEDCPVCEVAGRRF 2122.92
ASGKKVTL 802.49
NPSDPEHCQICHCDVVNL 2021.84
TCEACQEPGGL 1106.44
VVPPTDAPVSPTTL 1392.75
YVEDISEPPL 1160.56
VVDMMERL 991.48
RISQKWVRVAVVEYHDGSHAYIGL 2782.47
KDRKRPSEL 1127.64
RRIASQVKYAGSQVASTSEVL 2249.21
SKIDRPEASRIAL 1454.82
MASQEPQRMSRNF 1580.72
VRYVQGL 833.48
KKKKVIVIPVGIGPHANL 1910.22
IEKQAPENKAF 1273.67
EQQRDEIVSYL 1378.67
APEAPPPTL 891.47
PPHMAQVTVGPGL 1302.67
GPKRNSMVL 1000.55
EGSDKIGEADF 1166.51
MEEVIQRMDVGQDSIHVTVL 2298.13
QYSYMVTVEYPF 1525.68
SEAQSKGDIL 1046.52
QRVREIRYQGGNRTNTGL 2117.12
VSQGDREQAPNL 1312.64
VYMVTGNPASDEIKRL 1791.92
PGDIQVVPIGVGPNANVQEL 2015.07
ERIGWPNAPIL 1264.69
PREAPDL 796.41
QRCCSGEGL 951.39
SPAPDCSQPL 1013.45
DEMKSF 755.32
ISKANIGPRL 1067.64
QYGSITTIDVPWNVVPEKAHL 2366.23
VDVMQREGGPSQIGDAL 1770.86
TSEMHGARPGASKAVVIL 1822.97
VTDVSVDSVDAAADAARSNRVTVF 2464.22
PIGIGDRYDAAQL 1387.71
AGPAGDSNVVKL 1126.60
PTMVTL 660.35
VRICMDEDGNEKRPGDVWTL 2332.09
PDQCHTVTCQPDGQTL 1741.74
KSHRVNCDRGL 1283.65
RPSCPNSQSPVKVEETCGCRWTCPCVCTGS
STRHIVTF
4154.87
DGQNF 579.23
TGSCSYVL 828.37
QNKEQDL 873.42
HNGACSPGARQGCMKSIEVKHSAL 2480.18
HSDMEVTVNGRL 1356.65
VSVPYVGGNMEVNVYGAIMHEVRF 2666.30
TPQNNEF 848.37
ASKTYGL 738.39
CGICDENGANDF 1256.44
RDGTVTTDWKTL 1391.70
VQEWTVQRPGQTCQPIL 1982.00
VPDSSHCQVL 1083.50
AECHKVL 798.41
YAICQQDSCHQEQVCEVIASYAHL 2737.19
CRTNGVCVDWRTPDF 1767.78
CAMSCPPSL 907.36
VYNHCEHGCPRHCDGNVSSCGDHPSEGCF 3145.17
CPPDKVML 901.44
EGSCVPEEACTQCIGEDGVQHQF 2464.99
EAWVPDHQPCQICTCL 1841.79
SGRKVNCTTQPCPTAKAPTCGL 2232.08
CEVARL 689.35
RQNADQCCPEYECVCDPVSCDL 2488.94
PPVPHCERGL 1103.55
TNPGECRPNF 1133.49
TCACRKEECKRVSPPSCPPHRL 2496.20
RKTQCCDEYECACNCVNSTVSCPL 2668.05
ASTATNDCGCTTTTCL 1561.61
PDKVCVHRSTIYPVGQF 1944.99
WEEGCDVCTCTDMEDAVMGL 2205.80
RVAQCSQKPCEDSCRSGF 1999.87
HEGECCGRCL 1105.41
PSACEVVTGSPRGDSQSSWKSVGSQWASPE
NPCL
3532.60
INECVRVKEEVF 1463.74
IQQRNVSCPQL 1284.66
EVPVCPSGF 933.43
SCKTSACCPSCRCERMEACML 2310.88
NGTVIGPGKTVMIDVCTTCRCMVQVGVISG
F
3184.56
ECRKTTCNPCPL 1363.60
GYKEENNTGECCGRCL 1774.71
PTACTIQL 845.43
RGGQIMTL 874.47
KRDETL 760.41
QDGCDTHF 921.33
CKVNERGEYF 1243.57
WEKRVTGCPPF 1318.65
DEHKCL 743.33
AEGGKIMKIPGTCCDTCEEPECNDITARL 3096.37
QYVKVGSCKSEVEVDIHYCQGKCASKAMYS
IDINDVQDQCSCCSPTRTEPMQVAL
6086.74
HCTNGSVVYHEVL 1456.68
NAMECKCSPRKCSK 1583.70
TrypChymo F or Y or W or L or K or R in C term CAEGTR 635.27
AGGCQK 562.25
SIIGDF 650.33
VNGTVTQGDQR 1173.57
VSMPY 595.27
ETEAGY 668.26
IDGSGNF 708.31
MTQEGTL 778.35
SSGEQW 692.28
ASPPSSSCNISSGEMQK 1708.74
VDPEPF 702.32
CECAGGL 651.24
ECACPAL 705.28
TCAQEGMVL 950.42
TDHSACSPVCPAGMEY 1666.64
QCVSPCAR 862.38
HINEMCQER 1158.49
CVDGCSCPEGQL 1209.45
CVESTECPCVHSGK 1477.60
DCNTCICR 926.34
ICSNEECPGECL 1295.48
VTGQSHF 774.37
SGICQY 669.28
DCQDHSF 850.29
SIVIETVQCADDR 1447.70
DAVCTR 663.30
HGAGVAMDGQDIQL 1410.66
IQHTVTASVR 1110.61
NGNQGDDF 865.32
HGDCQDL 786.30
QHSDPCAL 869.37
SEEACAVL 820.36
DVCSCSDGR 940.34
AAACAGR 618.29
QCGTPCNL 834.34
PDEECNEACL 1121.40
GDCVPK 617.28
AQCPCY 683.24
QPEDIF 747.34
SDHHTMCY 992.35
MHCTMSGVPGSL 1218.52
VCPADNL 730.33
TCQNY 627.23
ECMSMGCVSGCL 1218.42
CPPGMVR 758.36
APGETVK 700.38
IGCNTCVCR 967.40
NCTDHVCDATCSTIGMAHY 2040.78
PGECQY 695.26
CGSNPGTF 781.31
GCSHPSVK 813.38
VEGGEIEL 844.42
DGEVNVK 759.38
EVVESGR 774.39
DGIQNNDL 887.40
QVEEDPVDF 1076.47
VSSQCADTR 965.42
DSSPATCHNNIMK 1416.61
QTMVDSSCR 1025.43
VDPEPY 718.32
DVCIY 611.26
DTCSCESIGDCACF 1452.47
CDTIAAY 755.32
AHVCAQHGK 949.45
CPQSCEER 950.36
NSCAPACQVTCQHPEPL 1796.76
ACPVQCVEGCHAHCPPGK 1834.77
QTCVDPEDCPVCEVAGR 1819.75
NPSDPEHCQICHCDVVNL 2021.84
TCEACQEPGGL 1106.44
VVPPTDAPVSPTTL 1392.75
VEDISEPPL 997.50
VVDMMER 878.40
HDGSHAY 785.31
IASQVK 644.39
AGSQVASTSEVL 1147.57
MASQEPQR 945.43
VIVIPVGIGPHANL 1397.84
QAPENK 685.34
DEIVSY 724.33
APEAPPPTL 891.47
PPHMAQVTVGPGL 1302.67
IGEADF 650.29
MEEVIQR 903.45
MDVGQDSIHVTVL 1412.70
MVTVEY 740.34
VSQGDR 660.32
EQAPNL 670.33
MVTGNPASDEIK 1260.60
PGDIQVVPIGVGPNANVQEL 2015.07
PNAPIL 623.36
CCSGEGL 667.23
SPAPDCSQPL 1013.45
ANIGPR 626.35
GSITTIDVPW 1087.55
NVVPEK 684.38
VDVMQR 746.37
EGGPSQIGDAL 1042.49
TSEMHGAR 887.39
VTDVSVDSVDAAADAAR 1660.79
PIGIGDR 726.40
AGPAGDSNVVK 1013.51
PTMVTL 660.35
ICMDEDGNEK 1152.44
PDQCHTVTCQPDGQTL 1741.74
PSCPNSQSPVK 1142.54
VEETCGCR 895.35
TCPCVCTGSSTR 1213.49
HIVTF 615.34
DGQNF 579.23
TGSCSY 616.22
HNGACSPGAR 968.42
QGCMK 565.23
HSDMEVTVNGR 1243.56
VGGNMEVNVY 1080.49
GAIMHEVR 911.46
TPQNNEF 848.37
CGICDENGANDF 1256.44
DGTVTTDW 893.38
PGQTCQPIL 955.48
VPDSSHCQVL 1083.50
AICQQDSCHQEQVCEVIASY 2252.95
TNGVCVDW 892.37
CAMSCPPSL 907.36
NHCEHGCPR 1051.41
HCDGNVSSCGDHPSEGCF 1849.64
EGSCVPEEACTQCIGEDGVQHQF 2464.99
VPDHQPCQICTCL 1455.63
VNCTTQPCPTAK 1261.58
APTCGL 560.26
QNADQCCPEY 1169.41
ECVCDPVSCDL 1181.44
PPVPHCER 933.45
TNPGECR 775.33
VSPPSCPPHR 1075.52
TQCCDEY 860.27
ECACNCVNSTVSCPL 1541.60
ASTATNDCGCTTTTCL 1561.61
VCVHR 612.32
EEGCDVCTCTDMEDAVMGL 2019.72
VAQCSQK 762.37
PCEDSCR 808.28
HEGECCGR 889.32
PSACEVVTGSPR 1201.58
GDSQSSW 765.29
ASPENPCL 829.36
NVSCPQL 759.36
EVPVCPSGF 933.43
TSACCPSCR 926.34
MEACML 696.26
NGTVIGPGK 841.47
TVMIDVCTTCR 1240.56
CMVQVGVISGF 1138.55
TTCNPCPL 847.36
EENNTGECCGR 1210.43
PTACTIQL 845.43
GGQIMTL 718.37
QDGCDTHF 921.33
VTGCPPF 719.33
IPGTCCDTCEEPECNDITAR 2168.85
SEVEVDIHY 1089.50
SIDINDVQDQCSCCSPTR 1982.81
TEPMQVAL 887.44
HCTNGSVVY 978.42
NAMECK 694.28
V8-DE D or E in C term MIPARFAGVLLALALILPGTLCAE 2452.39
GTRGRSSTARCSLFGSD 1756.83
FVNTFD 741.33
GSMYSFAGYCSYLLAGGCQKRSFSIIGD 2980.36
FQNGKRVSLSVYLGE 1695.89
IHLFVNGTVTQGD 1399.71
QRVSMPYASKGLYLE 1740.89
AGYYKLSGE 986.47
AYGFVARID 1010.52
GSGNFQVLLSD 1135.55
RYFNKTCGLCGNFNIFAE 2095.96
FANSWALSSGE 1167.52
RASPPSSSCNISSGE 1477.65
MQKGLWE 890.43
QCQLLKSTSVFARCHPLVD 2144.09
PFVALCE 777.37
CAGGLE 548.23
CACPALLE 818.37
YARTCAQE 940.41
GMVLYGWTD 1040.46
HSACSPVCPAGME 1287.50
YRQCVSPCARTCQSLHINE 2207.00
GCSCPE 594.18
CPCVHSGKRYPPGTSLSRD 2058.97
CNTCICRNSQWICSNE 1872.74
CLVTGQSHFKSFD 1467.68
NRYFTFSGICQYLLARD 2066.00
HSFSIVIE 930.48
TVQCAD 635.26
AVCTRSVTVRLPGLHNSLVKLKHGAGVAMD
3128.71
IQLPLLKGD 995.60
LRIQHTVTASVRLSYGE 1929.04
GRGRLLVKLSPVYAGKTCGLCGNYNGNQGD
3109.55
FLTPSGLAE 933.48
FGNAWKLHGD 1143.55
LQKQHSD 854.42
PCALNPRMTRFSE 1520.72
ACAVLTSPTFE 1137.54
ACHRAVSPLPYLRNCRYD 2133.04
VCSCSD 612.19
CLCGALASYAAACAGRGVRVAWRE 2453.19
LNCPKGQVYLQCGTPCNLTCRSLSYPD 2972.36
GCFCPPGLYMD 1201.46
CVPKAQCPCYYD 1388.56
HHTMCYCE 1022.34
GFMHCTMSGVPGSLLPD 1747.77
AVLSSPLSHRSKRSLSCRPPMVKLVCPAD 3133.67
CTKTCQNYD 1074.41
CMSMGCVSGCLCPPGMVRHE 2095.83
NRCVALE 803.40
RCPCFHQGKE 1203.53
TVKIGCNTCVCRD 1410.64
RKWNCTD 921.41
ATCSTIGMAHYLTFD 1629.72
GLKYLFPGE 1022.54
CQYVLVQD 966.45
YCGSNPGTFRILVGNKGCSHPSVKCKKRVT
ILVE
3689.93
VNVKRPMKD 1085.60
SGRYIILLLGKALSVVWD 2002.16
RHLSISVVLKQTYQE 1799.99
KVCGLCGNFD 1054.46
GIQNND 659.29
LTSSNLQVE 989.50
FGNSWKVSSQCAD 1427.61
TRKVPLD 827.49
SSPATCHNNIMKQTMVD 1875.83
SSCRILTSD 980.46
VCIYD 611.26
CACFCD 660.17
TIAAYAHVCAQHGKVVTWRTATLCPQSCE 3143.51
WRYNSCAPACQVTCQHPE 2091.87
PLACPVQCVE 1057.49
GCHAHCPPGKILD 1346.62
LLQTCVD 790.39
VAGRRFASGKKVTLNPSD 1902.04
HCQICHCD 957.32
VVNLTCE 776.37
PGGLVVPPTD 950.51
APVSPTTLYVE 1175.61
FYCSRLLD 1015.48
GSSRLSE 734.36
VLKAFVVD 889.53
RLRISQKWVRVAVVE 1838.10
GSHAYIGLKD 1059.53
LRRIASQVKYAGSQVASTSE 2150.14
VLKYTLFQIFSKID 1713.97
ASRIALLLMASQE 1401.76
PQRMSRNFVRYVQGLKKKKVIVIPVGIGPH
ANLKQIRLIE
4622.73
NKAFVLSSVD 1078.57
IVSYLCD 811.38
APPPTLPPHMAQVTVGPGLLGVSTLGPKRN
SMVLD
3546.91
VAFVLE 676.38
FNRSKE 779.39
SIHVTVLQYSYMVTVE 1867.94
AQSKGD 604.28
ILQRVRE 912.55
IRYQGGNRTNTGLALRYLSD 2267.18
HSFLVSQGD 988.46
QAPNLVYMVTGNPASD 1675.79
IKRLPGD 797.48
IQVVPIGVGPNANVQE 1632.88
RIGWPNAPILIQD 1491.82
LVLQRCCSGE 1106.52
GLQIPTLSPAPD 1207.64
CSQPLD 661.27
GSSSFPASYFD 1163.48
MKSFAKAFISKANIGPRLTQVSVLQYGSIT
TID
3583.94
VPWNVVPE 938.49
KAHLLSLVD 994.58
GGPSQIGD 729.33
ALGFAVRYLTSE 1325.70
MHGARPGASKAVVILVTD 1820.99
AARSNRVTVFPIGIGD 1671.91
AAQLRILAGPAGD 1251.69
SNVVKLQRIE 1184.69
LPTMVTLGNSFLHKLCSGFVRICMD 2781.38
VWTLPD 729.37
QCHTVTCQPD 1130.45
GQTLLKSHRVNCD 1469.74
RGLRPSCPNSQSPVKVE 1852.96
TCGCRWTCPCVCTGSSTRHIVTFD 2632.11
GQNFKLTGSCSYVLFQNKE 2162.05
VILHNGACSPGARQGCMKSIE 2170.04
VKHSALSVE 968.53
VTVNGRLVSVPYVGGNME 1889.97
VNVYGAIMHE 1131.54
VRFNHLGHIFTFTPQNNE 2170.07
FQLQLSPKTFASKTYGLCGICD 2419.19
GTVTTD 592.27
WKTLVQE 902.49
WTVQRPGQTCQPILE 1754.88
QCLVPD 673.31
SSHCQVLLLPLFAE 1555.81
CHKVLAPATFYAICQQD 1906.91
VIASYAHLCRTNGVCVD 1819.87
FCAMSCPPSLVYNHCE 1799.71
HGCPRHCD 923.35
GNVSSCGD 737.26
GCFCPPD 737.25
ACTQCIGE 823.32
GVQHQFLE 956.47
HQPCQICTCLSGRKVNCTTQPCPTAKAPTC
GLCE
3590.60
VARLRQNAD 1041.57
LPPVPHCE 890.43
RGLQPTLTNPGE 1281.67
CRPNFTCACRKE 1426.63
CKRVSPPSCPPHRLPTLRKTQCCD 2721.34
CACNCVNSTVSCPLGYLASTATND 2406.00
CGCTTTTCLPD 1113.41
KVCVHRSTIYPVGQFWE 2048.03
VCTCTD 640.22
AVMGLRVAQCSQKPCE 1718.83
SCRSGFTYVLHE 1397.64
CCGRCLPSACE 1140.42
VVTGSPRGD 886.45
SQSSWKSVGSQWASPE 1749.80
NPCLINE 801.37
CVRVKE 732.39
VFIQQRNVSCPQLE 1659.84
VPVCPSGFQLSCKTSACCPSCRCE 2504.04
ACMLNGTVIGPGKTVMID 1818.90
VCTTCRCMVQVGVISGFKLE 2172.06
CRKTTCNPCPLGYKE 1711.78
CCGRCLPTACTIQLRGGQIMTLKRD 2736.35
THFCKVNE 976.44
KRVTGCPPFD 1118.55
HKCLAE 699.34
GGKIMKIPGTCCD 1321.62
ITARLQYVKVGSCKSE 1780.95
IHYCQGKCASKAMYSID 1916.86
QCSCCSPTRTE 1213.45
PMQVALHCTNGSVVYHE 1883.87
CKCSPRKCSK 1138.54
Asp-N D in N term MIPARFAGVLLALALILPGTLCAEGTRGRS
STARCSLFGS
4076.18
DFVNTF 741.33
DGSMYSFAGYCSYLLAGGCQKRSFSIIG 2980.36
DFQNGKRVSLSVYLGEFF 2105.06
DIHLFVNGTVTQG 1399.71
DQRVSMPYASKGLYLETEAGYYKLSGEAYG
FVARI
3931.95
DGSGNFQVLLS 1135.55
DRYFNKTCGLCGNFNIFAE 2210.99
DFMTQEGTLTS 1228.53
DFANSWALSSGEQWCERASPPSSSCNISSG
EMQKGLWEQCQLLKSTSVFARCHPLV
6171.84
DPEPFVALCEKTLCECAGGLECACPALLEY
ARTCAQEGMVLYGWT
4853.17
DHSACSPVCPAGMEYRQCVSPCARTCQSLH
INEMCQERCV
4440.85
DGCSCPEGQLL 1120.45
DEGLCVESTECPCVHSGKRYPPGTSLSR 3006.36
DCNTCICRNSQWICSNEECPGECLVTGQSH
FKSF
3837.58
DNRYFTFSGICQYLLAR 2066.00
DHSFSIVIETVQCA 1547.73
DAVCTRSVTVRLPGLHNSLVKLKHGAGVAM
3128.71
DIQLPLLKG 995.60
DLRIQHTVTASVRLSYGE 2044.07
DGRGRLLVKLSPVYAGKTCGLCGNYNGNQG
3109.55
DFLTPSGLAEPRVE 1529.77
DFGNAWKLHG 1143.55
DLQKQHS 854.42
DPCALNPRMTRFSEEACAVLTSPTFEACHR
AVSPLPYLRNCRY
4884.32
DGRECLCGALASYAAACAGRGVRVAWREPG
RCELNCPKGQVYLQCGTPCNLTCRSLSYP
6291.93
DEECNEACLEGCFCPPGLYM 2221.81
DCVPKAQCPCYY 1388.56
DGEIFQPE 933.41
DHHTMCYCE 1137.37
DGFMHCTMSGVPGSLLP 1747.77
DAVLSSPLSHRSKRSLSCRPPMVKLVCPA 3133.67
DNLRAEGLECTKTCQNY 1956.87
DLECMSMGCVSGCLCPPGMVRHENRCVALE
RCPCFHQGKEYAPGETVKIGCNTCVCR
6218.70
DRKWNCT 921.41
DATCSTIGMAHYLTF 1629.72
DGLKYLFPGECQYVLVQ 1970.98
DYCGSNPGTFRILVGNKGCSHPSVKCKKRV
TILVEGGEIELF
4550.32
DGEVNVKRPMK 1271.67
DETHFEVVESGRYIILLLGKALSVVW 2972.60
DRHLSISVVLKQTYQEKVCGLCGNF 2836.44
DGIQNN 659.29
DLTSSNLQVEE 1233.57
DFGNSWKVSSQCA 1427.61
DTRKVPL 827.49
DSSPATCHNNIMKQTMV 1875.83
DSSCRILTS 980.46
DCNKLV 690.34
DPEPYL 732.33
DVCIY 611.26
DTCSCESIG 913.32
DCACFC 660.17
DTIAAYAHVCAQHGKVVTWRTATLCPQSCE
ERNLRENGYECEWRYNSCAPACQVTCQHPE
PLACPVQCVEGCHAHCPPGKIL
9078.10
DELLQTCV 919.43
DCPVCEVAGRRFASGKKVTLNPS 2433.23
DPEHCQICHC 1183.42
DVVNLTCEACQEPGGLVVPPT 2140.02
DAPVSPTTLYVE 1290.63
DISEPPLH 906.44
DFYCSRLL 1015.48
DGSSRLSEAEFEVLKAFVV 2082.06
DMMERLRISQKWVRVAVVEYH 2644.37
DGSHAYIGLK 1059.53
DRKRPSELRRIASQVKYAGSQVASTSEVLK
YTLFQIFSKI
4599.53
DRPEASRIALLLMASQEPQRMSRNFVRYVQ
GLKKKKVIVIPVGIGPHANLKQIRLIEKQA
PENKAFVLSSV
8002.52
DELEQQR 916.42
DEIVSYLC 940.42
DLAPEAPPPTLPPHMAQVTVGPGLLGVSTL
GPKRNSMVL
3957.12
DVAFVLEGS 935.46
DKIGEA 631.32
DFNRSKEFMEEVIQRM 2057.97
DSIHVTVLQYSYMVTVEYPFSEAQSKG 3077.47
DILQRVREIRYQGGNRTNTGLALRYLS 3161.72
DHSFLVSQG 988.46
DREQAPNLVYMVTGNPAS 1960.93
DEIKRLPG 926.52
DIQVVPIGVGPNANVQELERIGWPNAPILI
Q
3348.82
DFETLPREAP 1173.57
DLVLQRCCSGEGLQIPTLSPAP 2296.16
DCSQPL 661.27
DGSSSFPASYF 1163.48
DEMKSFAKAFISKANIGPRLTQVSVLQYGS
ITTI
3712.99
DVPWNVVPEKAHLLSLV 1915.06
DVMQREGGPSQIG 1372.64
DALGFAVRYLTSEMHGARPGASKAVVILVT
3128.68
DAARSNRVTVFPIGIG 1671.91
DAAQLRILAGPAG 1251.69
DSNVVKLQRIE 1299.71
DLPTMVTLGNSFLHKLCSGFVRICM 2781.38
DGNEKRPG 871.41
DVWTLP 729.37
DQCHTVTCQP 1130.45
DGQTLLKSHRVNC 1469.74
DRGLRPSCPNSQSPVKVEETCGCRWTCPCV
CTGSSTRHIVTF
4596.10
DGQNFKLTGSCSYVLFQNKEQ 2405.13
DLEVILHNGACSPGARQGCMKSIEVKHSAL
SVELHS
3814.89
DMEVTVNGRLVSVPYVGGNMEVNVYGAIMH
EVRFNHLGHIFTFTPQNNEFQLQLSPKTFA
SKTYGLCGIC
7816.82
DENGAN 618.22
DWKTLVQEWTVQRPGQTCQPILEEQCLVP 3423.70
DSSHCQVLLLPLFAECHKVLAPATFYAICQ
Q
3444.70
DSCHQEQVCEVIASYAHLCRTNGVCV 2863.25
DFCAMSCPPSLVYNHCEHGCPRHC 2705.05
DGNVSSCG 737.26
DHPSEGCFCPP 1187.44
DKVMLEGSCVPEEACTQCIGE 2239.95
DGVQHQFLEAWVP 1524.74
DHQPCQICTCLSGRKVNCTTQPCPTAKAPT
CGLCEVARLRQNA
4614.16
DQCCPEYECVC 1290.40
DLPPVPHCERGLQPTLTNPGECRPNFTCAC
RKEECKRVSPPSCPPHRLPTLRKTQCC
6395.08
DEYECACNCVNSTVSCPLGYLASTATN 2827.14
DCGCTTTTCLP 1113.41
DKVCVHRSTIYPVGQFWEEGC 2452.13
DVCTCT 640.22
DAVMGLRVAQCSQKPCE 1833.85
DSCRSGFTYVLHEGECCGRCLPSACEVVTG
SPRG
3574.55
DSQSSWKSVGSQWASPENPCLINECVRVKE
EVFIQQRNVSCPQLEVPVCPSGFQLSCKTS
ACCPSCRCERMEACMLNGTVIGPGKTVMI
9721.52
DVCTTCRCMVQVGVISGFKLECRKTTCNPC
PLGYKEENNTGECCGRCLPTACTIQLRGGQ
IMTLKR
7228.41
DTHFCKVNERGEYFWEKRVTGCPPF 3044.41
DEHKCLAEGGKIMKIPGTCC 2131.99
DTCEEPECN 1038.33
DITARLQYVKVGSCKSEVEV 2223.16
DIHYCQGKCASKAMYSI 1916.86
DQCSCCSPTRTEPMQVALHCTNGSVVYHEV
LNAMECKCSPRKCSK
4972.18
Asp-N_ambic D or E in N term MIPARFAGVLLALALILPGTLCA 2323.35
EGTRGRSSTARCSLFGS 1770.84
DFVNTF 741.33
DGSMYSFAGYCSYLLAGGCQKRSFSIIG 2980.36
DFQNGKRVSLSVYLG 1681.88
DIHLFVNGTVTQG 1399.71
DQRVSMPYASKGLYL 1726.87
EAGYYKLSG 986.47
EAYGFVARI 1024.53
DGSGNFQVLLS 1135.55
DRYFNKTCGLCGNFNIFA 2081.94
DFMTQ 640.25
EGTLTS 606.29
DFANSWALSSG 1153.50
ERASPPSSSCNISSG 1477.65
EMQKGLW 890.43
EQCQLLKSTSVFARCHPLV 2158.10
EPFVALC 777.37
ECAGGL 548.23
ECACPALL 818.37
EYARTCAQ 940.41
EGMVLYGWT 1054.48
DHSACSPVCPAGM 1273.49
EYRQCVSPCARTCQSLHIN 2207.00
DGCSCP 580.16
ECPCVHSGKRYPPGTSLSR 2072.99
DCNTCICRNSQWICSN 1858.72
ECLVTGQSHFKSF 1481.70
DNRYFTFSGICQYLLAR 2066.00
DHSFSIVI 916.46
ETVQCA 649.27
DAVCTRSVTVRLPGLHNSLVKLKHGAGVAM
3128.71
DIQLPLLKG 995.60
DLRIQHTVTASVRLSYG 1915.03
DGRGRLLVKLSPVYAGKTCGLCGNYNGNQG
3109.55
DFLTPSGLA 919.46
DFGNAWKLHG 1143.55
DLQKQHS 854.42
DPCALNPRMTRFS 1506.71
EACAVLTSPTF 1137.54
EACHRAVSPLPYLRNCRY 2147.05
ECLCGALASYAAACAGRGVRVAWR 2453.19
ELNCPKGQVYLQCGTPCNLTCRSLSYP 2986.38
EGCFCPPGLYM 1215.48
DCVPKAQCPCYY 1388.56
DHHTMCYC 1008.32
DGFMHCTMSGVPGSLLP 1747.77
DAVLSSPLSHRSKRSLSCRPPMVKLVCPA 3133.67
ECTKTCQNY 1088.43
ECMSMGCVSGCLCPPGMVRH 2095.83
ENRCVAL 803.40
ERCPCFHQGK 1203.53
ETVKIGCNTCVCR 1424.66
DRKWNCT 921.41
DATCSTIGMAHYLTF 1629.72
DGLKYLFPG 1008.53
ECQYVLVQ 980.46
DYCGSNPGTFRILVGNKGCSHPSVKCKKRV
TILV
3675.92
EVNVKRPMK 1099.62
ESGRYIILLLGKALSVVW 2016.18
DRHLSISVVLKQTYQ 1785.97
EKVCGLCGNF 1068.47
DGIQNN 659.29
DLTSSNLQV 975.49
DFGNSWKVSSQCA 1427.61
DTRKVPL 827.49
DSSPATCHNNIMKQTMV 1875.83
DSSCRILTS 980.46
DCNKLV 690.34
DVCIY 611.26
DCACFC 660.17
DTIAAYAHVCAQHGKVVTWRTATLCPQSC 3129.49
EWRYNSCAPACQVTCQHP 2091.87
EPLACPVQCV 1057.49
EGCHAHCPPGKIL 1360.64
ELLQTCV 804.40
EVAGRRFASGKKVTLNPS 1916.06
EHCQICHC 971.34
DVVNLTC 762.36
EPGGLVVPPT 964.52
DAPVSPTTLYV 1161.59
DFYCSRLL 1015.48
DGSSRLS 720.34
EVLKAFVV 903.54
ERLRISQKWVRVAVV 1838.10
DGSHAYIGLK 1059.53
ELRRIASQVKYAGSQVASTS 2150.14
EVLKYTLFQIFSKI 1727.99
EASRIALLLMASQ 1401.76
EPQRMSRNFVRYVQGLKKKKVIVIPVGIGP
HANLKQIRLI
4622.73
ENKAFVLSSV 1092.58
EIVSYLC 825.39
EAPPPTLPPHMAQVTVGPGLLGVSTLGPKR
NSMVL
3560.92
DVAFVL 662.36
DFNRSK 765.38
EVIQRM 774.41
DSIHVTVLQYSYMVTV 1853.92
EAQSKG 618.30
DILQRVR 898.53
EIRYQGGNRTNTGLALRYLS 2281.19
DHSFLVSQG 988.46
EQAPNLVYMVTGNPAS 1689.80
EIKRLPG 811.49
DIQVVPIGVGPNANVQ 1618.87
ERIGWPNAPILIQ 1505.83
DLVLQRCCSG 1092.51
EGLQIPTLSPAP 1221.66
DCSQPL 661.27
DGSSSFPASYF 1163.48
EMKSFAKAFISKANIGPRLTQVSVLQYGSI
TTI
3597.96
DVPWNVVP 924.47
EKAHLLSLV 1008.60
EGGPSQIG 743.34
DALGFAVRYLTS 1311.68
EMHGARPGASKAVVILVT 1835.01
DAARSNRVTVFPIGIG 1671.91
DAAQLRILAGPAG 1251.69
DSNVVKLQRI 1170.67
DLPTMVTLGNSFLHKLCSGFVRICM 2781.38
DVWTLP 729.37
DQCHTVTCQP 1130.45
DGQTLLKSHRVNC 1469.74
DRGLRPSCPNSQSPVKV 1838.94
ETCGCRWTCPCVCTGSSTRHIVTF 2646.13
DGQNFKLTGSCSYVLFQNK 2148.03
EVILHNGACSPGARQGCMKSI 2170.04
EVKHSALSV 968.53
EVTVNGRLVSVPYVGGNM 1889.97
EVNVYGAIMH 1131.54
EVRFNHLGHIFTFTPQNN 2170.07
EFQLQLSPKTFASKTYGLCGIC 2433.21
DWKTLVQ 888.47
EWTVQRPGQTCQPIL 1754.88
EQCLVP 687.33
DSSHCQVLLLPLFA 1541.79
ECHKVLAPATFYAICQQ 1920.92
DSCHQ 588.20
EVIASYAHLCRTNGVCV 1833.89
DFCAMSCPPSLVYNHC 1785.70
EHGCPRHC 937.36
DGNVSSCG 737.26
EGCFCPP 751.27
EACTQCIG 823.32
DGVQHQFL 942.46
DHQPCQICTCLSGRKVNCTTQPCPTAKAPT
CGLC
3576.59
EVARLRQNA 1055.58
DLPPVPHC 876.42
ERGLQPTLTNPG 1281.67
ECRPNFTCACRK 1426.63
ECKRVSPPSCPPHRLPTLRKTQCC 2735.36
ECACNCVNSTVSCPLGYLASTATN 2420.01
DCGCTTTTCLP 1113.41
DKVCVHRSTIYPVGQFW 2034.01
DVCTCT 640.22
DAVMGLRVAQCSQKPC 1704.81
DSCRSGFTYVLH 1383.62
ECCGRCLPSAC 1140.42
EVVTGSPRG 900.47
DSQSSWKSVGSQWASP 1735.78
ENPCLIN 801.37
ECVRVK 732.39
EVFIQQRNVSCPQL 1659.84
EVPVCPSGFQLSCKTSACCPSCRC 2504.04
EACMLNGTVIGPGKTVMI 1832.92
DVCTTCRCMVQVGVISGFKL 2158.04
ECRKTTCNPCPLGYK 1711.78
ECCGRCLPTACTIQLRGGQIMTLKR 2750.36
DTHFCKVN 962.43
EKRVTGCPPF 1132.57
EHKCLA 699.34
EGGKIMKIPGTCC 1335.63
DITARLQYVKVGSCKS 1766.93
DIHYCQGKCASKAMYSI 1916.86
DQCSCCSPTRT 1199.44
EPMQVALHCTNGSVVYH 1883.87
ECKCSPRKCSK 1267.58